Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Belongs to the cytochrome c family.

112 amino acids

MSTFAEAPAGDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKANKEAAVTWGESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAYLKQATA

12 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CYC1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here