Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

210 amino acids

MHLNQLVISHLACERGENRLFEGCHFSVSSGEWVQIEGHNGIGKTSLLRILAGLALPVAGEVLWNNLSIHKQRDEYYAELFYLGHYAGIKPELSAWENLRFYQKMQGLSLDDEALWFALDKVSLVERADLPCSYLSAGQQRRVALAKLWLTQQKLWILDEPFTAIDNHGVGDLIMHIERHCSLGGMAIFTSHQTVESNKVRTLSLDQFKL

23.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ccmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here