About Products Protein Database Contact

Protein expression services for avrPph3 | Cysteine protease avirulence protein AvrPphB

Description
Cysteine protease avirulence protein, which is essential during infection of plant cells from cultivar-specific of beans and Arabidopsis thaliana. The autocleavage of the protein is required for virulence function. May act by affecting the plant defense system. In plants lacking R3 or RPS5 resistance genes, it probably impairs the plant defense system and leads to the bacteria multiplication. In contrast, in plants containing the R3 or RPS5 protein, it is unable to induce disease symptoms, explaining its avirulence name. The 7 kDa product is required for the type-III translocation from Pseudomonas strains to the plant, but are partially dispensable for effector recognition following in planta expression. In infected plants, it acts by cleaving the PBS1 protein, which leads to resistance or disease, depending on the presence or absence of RPS5, respectively (PubMed:11952132, PubMed:17277084). Targets the Arabidopsis kinases PBS1, BIK1, PBL1, PBL2, PBL3, PBL5, PBL7, PBL9 and PBL11 for cleavage in vitro (PubMed:20413097). Can block recognition of AvrB avirulence factor by plant cells by cleaving Arabidopsis RIPK kinase and suppressing Arabidopsis RPM1 activation. Cannot block AvrRpm1-induced activation of RPM1 (PubMed:25625821).
Family
Belongs to the peptidase C58 family.
Species
Pseudomonas savastanoi pv. phaseolicola
Length
267 amino acids
Sequence
MKIGTQATSLAVLHNQESHAPQAPIAVRPEPAHAIPEIPLDLAIRPRTRGIHPFLAMTLGDKGCASSSGVSLEDDSHTQVSLSDFSVASRDVNHNNICAGLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSNDDEAPFFTASTAVIEDAGFSLRREPKTVHASGGSAQLGQTVAHDVAQSGRKHLLSLRFANVQGHAIACSCEGSQFKLFDPNLGEFQSSRSAAPQLIKGLIDHYNSLNYDVACVNEFRVS
Mass
28.7 kDa
Simulated SDS-PAGE
Western blot of avrPph3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make avrPph3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here