About Products Protein Database Contact

Protein expression services for iscS | Cysteine desulfurase IscS

Description
Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.
Family
Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.
Species
Rickettsia prowazekii (strain Madrid E)
Length
410 amino acids
Sequence
MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVENARSMVAKVIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKKHIITLVSEHKCVLNACRHLEQEGIKITYLPIKSNGIIDLETLKNAITDQTLLVSVMAVNNEIGVIQPLKEIGKICRERNVFFHSDIAQGFGKIPINVNECNIDLASISGHKIYGPKGIGALYIRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGIASEIAYNEMEKDTQHVNYLFDRFLNNIHSKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLVCSKIDKLRRLSPLWEMMQEGVDLKKIRWTAH
Mass
45.6 kDa
Simulated SDS-PAGE
Western blot of iscS recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make iscS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here