Description
Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.
Family
Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Sequence
MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGWKAEEVVDIARNQISELIGADSREIVFTSGATESNNLAIKGIASFHQNKGKHIVTSKTEHKSVLDTCRYLENKGFTVTYLTPKNNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDINSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRKPRVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGIKNIEEVYLNSDLQQGAPHILNVSFNYVEGESLIMALKDLAISSGSACTSASLEPSYVLKSLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLNSIEWDHV
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service