Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. May regulate early lateral root initiation by blocking the G1/S phase transition. Controls the mitosis-to-endocycle transition and the onset of the endoreduplication cycle during leaf development through inhibition of mitotic CDKA-1 kinase complexes. Specifically targets CDKA-1.

Belongs to the CDI family. ICK/KRP subfamily.

209 amino acids

MAAVRRRERDVVEENGVTTTTVKRRKMEEEVDLVESRIILSPCVQATNRGGIVARNSAGASETSVVIVRRRDSPPVEEQCQIEEEDSSVSCCSTSEEKSKRRIEFVDLEENNGDDRETETSWIYDDLNKSEESMNMDSSSVAVEDVESRRRLRKSLHETVKEAELEDFFQVAEKDLRNKLLECSMKYNFDFEKDEPLGGGRYEWVKLNP

24 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make KRP2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here