Protein expression services for bir-1 | Chromosomal passenger complex protein bir-1
Description
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of chromosome segregation and cytokinesis (PubMed:12707312, PubMed:10209096, PubMed:10983970). The CPC complex has essential functions at the centromere in ensuring correct chromosome condensation, alignment and segregation (PubMed:12707312, PubMed:10983970). In the complex, required to direct the Aurora B/air-2 kinase to chromosomes (PubMed:12707312, PubMed:10983970). Also functions in spindle midzone formation and in the formation of polar bodies during oogenesis (PubMed:10209096, PubMed:10983970). Required for the localization of the kinetochore component hcp-1 to chromosomes (PubMed:10983970). Involved in the positive regulation of transcription (PubMed:12682297). Involved in the transcriptional regulation of collagen genes (PubMed:17116281).
Family
Belongs to the IAP family.
Species
Caenorhabditis elegans
Length
155 amino acids
Sequence
MAPGTKKKSDMAKFTFYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYCTGPQSGKCAFCNKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTINDTVRLSQTAMIMTKLFEHEMMINNLSNHSSSDALFDQLKKVPNTASTTKSNSRRGK
Mass
17.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make bir-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here