About Products Protein Database Contact

Protein expression services for CASP3 | Casparian strip membrane protein 3

Description
Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.
Family
Belongs to the Casparian strip membrane proteins (CASP) family.
Species
Arabidopsis thaliana
Length
221 amino acids
Sequence
MDIEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQGTSGAVVASFIAATLLMFLVILSAFALKRTT
Mass
24.2 kDa
Simulated SDS-PAGE
Western blot of CASP3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CASP3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here