Protein expression services for csa5 | CRISPR type I-A cluster 2/Apern-associated protein Csa5-2
Description
In strain P2 toxic when expressed in vivo in the absence of CRISPR loci A-D (strain P2 contains 6 CRISPR loci in all). It causes strong growth inhibition, a significant proportion of cells have degraded or no DNA by 20-24 post-induction (PubMed:25277654).
Species
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Length
150 amino acids
Sequence
MAQKSEKENIIGRIANLLAVGFLYSESPTLVDRFANALSKEAVTKVLYDVQRIVQMGIDRSEIATTTITIQGKDYPAQGKDYPAVNVNSSGAKYTVVGYLPTSQDIEDFLRMIEEDVYYARKAGALAMSIANRIKLGSKQSKSEQGGEKK
Mass
16.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make csa5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here