Adapter protein required for olfactory adaptation and recovery to volatile odorants, probably by desensitization of G-protein coupled receptors (GPCR) (PubMed:15878875). May play a role in clathrin-mediated GPCR endocytosis (PubMed:15878875). Acts as positive regulator of insulin-like daf-2 signaling pathway probably by forming a complex with mpz-1 and phosphatase daf-18 likely resulting in daf-18 inhibition (PubMed:20207731). Involved in egg-laying (PubMed:15878875).

Belongs to the arrestin family.

435 amino acids

MVDEDKKSGTRVFKKTSPNGKITTYLGKRDFIDRGDYVDLIDGMVLIDEEYIKDNRKVTAHLLAAFRYGREDLDVLGLTFRKDLISETFQVYPQTDKSISRPLSRLQERLKRKLGANAFPFWFEVAPKSASSVTLQPAPGDTGKPCGVDYELKTFVAVTDGSSGEKPKKSALSNTVRLAIRKLTYAPFESRPQPMVDVSKYFMMSSGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIYIIQVADICLFTTASYSCEVARIESNEGFPVGPGGTLSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGIVVQYRVKVRAVLGPLNGELFAELPFTLTHSKPPESPERTDRGLPSIEATNGSEPVDIDLIQLHEELEPRYDDDLIFEDFARMRLHGNDSEDQPSPSANLPPSLL

48.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arr-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here