Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex (By similarity).

Belongs to the amino acid/polyamine transporter 2 family. Amino acid/auxin permease (AAAP) (TC 2.A.18.1) subfamily.

488 amino acids

MSGEKQAEESIVVSGEDEVAGRKVEDSAAEEDIDGNGGNGFSMKSFLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGILLQIFYGLMGSWTAYLISVLYVEYRARMEKQEAKSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASFLHGQAEGVTHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFIRQIDTFGLFAKCYQCKPPPAPIAAGAHHRR

54.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LAX1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here