Catalyzes the final step in the conversion of aurachin C to aurachin B. Catalyzes the reduction of 4-hydroxy-2-methyl-3-oxo-4-((2E,6E)-farnesyl)-3,4-dihydroquinoline-1-oxide to form 2-methyl-1-oxo-4-((2E,6E)-farnesyl)-3,4-dihydroquinoline-3,4-diol, which then undergoes a spontaneous dehydration to form aurachin B. Accepts both NADH and NADPH, but has a preference for NADH.

Belongs to the 3-beta-HSD family.

334 amino acids

MRTFVTGGSGYLGRNLLSALVARGISVRALVRSEEAAQKVQALGAQPILGTLEHRETLKEGMAGCDVLFHAAALTSARATDAEFHRANVLGTETVLAAARDARIQRMVHVSTEAVLADGRPLLQVDESHPLPKRPFAGYPATKAQAEQLVLQANGPGFTTVVVRPRFIWGADDTAFLPQLIDAIRTKRFRWVDGGRYLTSTCHVANVCEGMLLAAERGPGGEVYFLTDGAPVELRSFLTLLLETQGIKAEVGNIPFQAARAAAHLGESLWRALVPQARAPALRLAVYLLGREVTLNDDKARRELGYAGRVTHQQGLDALRQAGPAGQGAMPHRA

35.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make auaH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here