May play a role in host B-cell survival by preventing host apoptosis. The survival of infected B-cells is a key step to induce host cell differentiation into memory cells, thereby assuring long term infection of the organism. May also play an active part in oncogenesis in Burkitt's lymphomy and nasopharyngeal carcinoma (By similarity).

Belongs to the Epstein-Barr virus BALF1 family.

220 amino acids

MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL

25.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BALF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here