About Products Protein Database Contact

Protein expression services for Avil | Advillin

Description
Ca(2+)-regulated actin-binding protein. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. Involved in the formation of long fine actin-containing filopodia-like structures in fibroblast. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in ciliogenesis.
Family
Belongs to the villin/gelsolin family.
Species
Rattus norvegicus
Length
829 amino acids
Sequence
MXXXSLSSAFRTVTNDPGIITWRIEKMELVLVPLSAHGNFYEGDCYIILSTRRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKRGIIYKKGGVASGMKHVETFSYDVKRLLHVKGKRNIRATEVEMSWDSFNQGDVFLLDLGMVIIQWNGPESNSGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQNTLGRRSIIKPAVPSEVTDQQQKSTIMLYHVSDTTGQLSVTEVATRPLVQELLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSSTNVETVNDGAESAMFKQLFQKWSVKDQTTGLGKTFSIGKIAKIFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWHGFFYGGDCYLVLYTYDVNGKPCYILYIWQGRHASQDELAASAYQAVEVDQQFGGAPVQVRVSMGKEPRHFMAIFKGKLVIYERGTSRKGNVEPDPPVRLFQIHGNDKSNTKAVEVSASASSLNSNDVFLLWTQAEHYLWYPKGSSGDERAMAKELAELLCDGDADTVAEGQEPPEFWDLLGGKAPYANDKRLQQETLDIQVRLFECSNKTGRFLVTEVTDFTQDDLSPGDVMLLDTWDQVFLWIGAEANATEKEGALSTAQEYLVTHPSGRDPDTPILIIKQGFEPPTFTGWFLAWDPHIWSEGKSYEQLKNELGDATAIVRITTDMKNATLSLNSSESGPKYYPVEVLLKSQDQELPEDVDPTKKENYLSXERDFVSVFGITRGQFVSLPGWKQLQLKKEAGLF
Mass
93 kDa
Simulated SDS-PAGE
Western blot of Avil recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Avil using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here