This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction.

Belongs to the ATPase delta chain family.

180 amino acids

MISNAIARRYAKALVQLGAEEDAVDRFGAELGQFAALLEGNADIDSVLKSPAYRIEAKREILKDVLAKLSLSGTVSNFLQVLLDRGRISFLPQIAHSYAAFADELSGVIRPVLTSAFPLEDAQVESMKGALVKATGKKVQLSVQVEPSLIGGVITKIGDKVFDGSVRTQLNRIQDILQKG

19.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make atpH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here