Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits.

Belongs to the ATPase C chain family.

81 amino acids

MNPLISASSVVAAGLAIGLAAIGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALVLLFANPFS

8.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make atpH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here