Binds mRNA; thus facilitating recognition of the initiation point. It is needed to translate mRNA with a short Shine-Dalgarno (SD) purine-rich sequence (By similarity).

Belongs to the bacterial ribosomal protein bS1 family.

551 amino acids

MSETFAELFEKSLTETDLRPGALVKATVVEVRPDRVIVNAGLKSEGIIPASEFRNEEPHVGDEFFVVIEASDNGFGETRLSREKARRAKAWSELEKAYKAGEMVKGVIIERVKGGFTVDLNSVRAFLPGSLVDVKPVRDPGYLEDKEIDFKIIKMDQRRNNVVVSRRAVMEAETSAERQARLEELQEGQEIKGVIKNITDYGAFVDLGGVDGLLHITDMAWGRVKHPSDLLNVGDEVHVKVLKFDRDKKRVSLGMKQLADDPWAKIERRYPVNSRVFGKVTNITDYGCFVKLEEGVEGLVHTSELDWTNKNIHPSKVVQSGEEVEVMVLEIDEERRRISLGIKQCKRNPWQEFAEKHEKDEKITGKVRSITDFGMFIGLEGDIDGLVHLSDISWTESGEEAIRNYKKGDEVQAVILGIDPERERISLGIKQLEGDPFMEFVESYDKDAVIQAKVKEVESKQAVLELADQVLGQMRLADYTYDRVKDLTQELNVGDEVAVKIVNVDRKNRLINVSHKAVEGRSEKGTRTVSDVPTKTTLGDLLKEKIQSKDE

62.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpsA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here