Protein
GTP pyrophosphokinase YwaC
Organism
Bacillus subtilis (strain 168)
Function
Functions as a (p)ppGpp synthase; GDP can be used instead of GTP, resulting in an increase of (p)ppGpp synthesis (PubMed:18067544). Overexpression in relA mutants (triple relA-yjbM-ywaC deletions and single relA deletions) leads to growth arrest; GTP levels fall drastically, various guanine-related nucleotides are synthesized (ppGp or pGpp), the cellular transcriptional profile changes dramatically and 70S ribosome dimerization occurs (PubMed:22950019). Overexpression in the presence of a wild-type relA gene does not have these effects (PubMed:22950019). In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to changes in nutritional abundance. activities in response to changes in nutritional abundance. YwaC has probably a minor role in stringent response (PubMed:18067544).
Similarity
Belongs to the RelA/SpoT family.
Sequence
MDLSVTHMDDLKTVMEDWKNELLVYKFALDALDTKFSIISQEYNLIHGHNPIEHTKSRVKSFESIVNKLMRKGCEITTKEMKEHIHDIAGVRIICSFISDIYNVVNVLKQHEDLRIVKVKDYIQTPKPNGYRSLHLIIEMPVNLTNRVEYVKAEIQIRTIAMDFWASLEHKIYYKLNNDVPKQLTDELKEAAEIAHYLDEKMLGIKKEVD