yoeB

Uncharacterized protein YoeB

181 amino acids

20.138 kDa

MKKCLLFLTTIALILSLSTNAFAKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI

yoeB

Toxin YoeB

86 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides (By similarity).

Belongs to the YoeB family.

10.347 kDa

MKIAFTELSWHDYLWFQQNDKKLLKRINLLIKAIARDPFDGIGKPEPLKANLSGYWSRRINSEHRLVYTIADRDLLIISCRFHYQR

yoeB

Toxin YoeB

85 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides (By similarity).

Belongs to the YoeB family.

10.102 kDa

MRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLKARYHY

yoeB

Toxin YoeB

84 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. It has been proposed to be an mRNA interferase but also an inhibitor of translation initiation. Has an in vitro RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. YefM binds to the promoter region of the yefM-yeoB operon to repress transcription, YeoB acts as a corepressor (By similarity).

Belongs to the YoeB family.

10.216 kDa

MKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY

yoeB

Toxin YoeB

84 amino acids

Also shown in vitro to be a translation initiation blocker. Binds to the 70S ribosome and 50S ribosomal subunit; binding is inhibited by hygromycin A and tetracycline, both of which bind to the 30S subunit in the A site. Thus YoeB is located at the interface between 50S and 30S ribosomes and interacts with the A site where it cleaves mRNA, blocking translation initiation.

Belongs to the YoeB family.

10.216 kDa

MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY

yoeB

Toxin YoeB

84 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. It has been proposed to be an mRNA interferase but also an inhibitor of translation initiation. Has an in vitro RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. YefM binds to the promoter region of the yefM-yeoB operon to repress transcription, YeoB acts as a corepressor (By similarity).

Belongs to the YoeB family.

10.216 kDa

MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY

yoeB

Toxin YoeB

84 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides (By similarity).

Belongs to the YoeB family.

9.986 kDa

MRITFTSHGWEDYVHWAESDRKVTKRINRLIADIARDPFKGVGKPEPLKGDLSGYWSRRIDDTHRLVYKPTDDQLVIVQARYHY