About Services Proteins Contact

yjjW

Gene
yjjW
Protein
Putative glycyl-radical enzyme activating enzyme YjjW
Organism
Escherichia coli (strain K12)
Length
287 amino acids
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
31.491 kDa
Sequence
MNSRCALVSKIIPFSCVDGPGSRLALFLQGCNLRCKNCHNPWTMGRCNDCGECVPQCPHQALQIVDGKVVWNAVVCEQCDTCLKRCPQHATPMAQSMSVDEVLSHVRKAVLFIEGITVSGGEATTQLPFVVALFTAIKNDPQLRHLTCLVDSNGMLSETGWEKLLPVCDGAMLDLKAWGSECHQQLTGRDNQQIKRSIYLLAERGKLAELRLLVIPGQVDYLQHIEELAAFIKGLGDVPVRLNAFHAHGVYGEAQSWASATPEDVEPLADALKVRGVSRLIFPALYL