About Services Proteins Contact

yjcZ

Gene
yjcZ
Protein
Uncharacterized protein YjcZ
Organism
Escherichia coli (strain K12)
Length
292 amino acids
Mass
32.899 kDa
Sequence
MTKTLLDGPGRVLESVYPRFLVDLAQGDDARLPQAHQQQFRERLMQELLSRVQLQTWTNGGMLNAPLSLRLTLVEKLASMLDPGHLALTQIAQHLALLQKMDHRQHSAFPELPQQIAALYEWFSARCRWKEKALTQRGLLVQAGDQSEQIFTRWRAGAYNAWSLPGRCFIVLEELRWGAFGDACRLGSPQAVALLLGDLLEKATQHLAESINAAPTTRHYYHQWFASSTVPTGGEHADFLSWLGKWTTADKQPVCWSVTQRWQTVALGMPRLCSAQRLAGAMLEEIFSVNLA

Gene
yjcZ
Protein
Sporulation protein YjcZ
Organism
Bacillus subtilis (strain 168)
Length
49 amino acids
Similarity
Belongs to the SscA family.
Mass
4.861 kDa
Sequence
MGFGYGFGGGYGGGCYGGYAGGYGGGYGSTFVLLVVLFILLIIVGASFF