About Services Proteins Contact

yitZ

Gene
yitZ
Protein
Uncharacterized MFS-type transporter YitZ
Organism
Bacillus subtilis (strain 168)
Length
164 amino acids
Similarity
Belongs to the major facilitator superfamily.
Mass
18.353 kDa
Sequence
MFFASSLIFPFYILFVKNIGSSYTQFGFSYGLFGLSGALIYPLLGRLSERFDSRYFLLLNSWGMAVLLLYVPHIGSVVQVYIVQVLLGLFGAMQKHGEKVLIANFTDSGERGKKIGNYHFWTAVFSAAAIMLGGFLADFFTVQMIFYASSILYFLSGLMMMKTG