About Services Proteins Contact

yidX

Gene
yidX
Protein
Uncharacterized protein YidX
Organism
Escherichia coli (strain K12)
Length
218 amino acids
Mass
24.17 kDa
Sequence
MKLNFKGFFKAAGLFPLALMLSGCISYALVSHTAKGSSGKYQSQSDTITGLSQAKDSNGTKGYVFVGESLDYLITDGADDIVKMLNDPALNRHNIQVADDARFVLNAGKKKFTGTISLYYYWNNEEEKALATHYGFACGVQHCTRSLENLKGTIHEKNKNMDYSKVMAFYHPFKVRFYEYYSPRGIPDGVSAALLPVTVTLDIITAPLQFLVVYAVNQ

Gene
yidX
Protein
Uncharacterized protein YidX
Organism
Shigella flexneri
Length
218 amino acids
Mass
24.17 kDa
Sequence
MKLNFKGFFKAAGLFPLALMLSGCISYALVSHTAKGSSGKYQSQSDTITGLSQAKDSNGTKGYVFVGESLDYLITDGADDIVKMLNDPALNRHNIQVADDARFVLNAGKKKFTGTISLYYYWNNEEEKALATHYGFACGVQHCTRSLENLKGTIHEKNKNMDYSKVMAFYHPFKVRFYEYYSPRGIPDGVSAALLPVTVTLDIITAPLQFLVVYAVNQ