ygfX

Inner membrane protein YgfX

143 amino acids

Required for production of prodigiosin antibiotic (Pig); overproduction in ygfX, sdhE or double sdhE-ygfX deletion mutants leads to nearly 10-fold increased synthesis of Pig (PubMed:22474332, PubMed:23657679). Overexpressing cells have somewhat altered cell length depending on growth phase (PubMed:23657679). Does not function as a toxin; overexpression in the presence or absence of sdhE (the putative antitoxin) has no effect on growth rate (PubMed:23657679).

17.276 kDa

MVQWQCNLRVSWRMQLFSLLAHGLLVLLILLAPWPDGYMSVWLGLVTLVMFGFIRSQRNIKSRHGEIVLYNENHLRWQHREWQITKRPWVLKNGILLSLRTTEGKGPRRRSLWLASDSMRNEEWRHLCHLLLQHKNWQSDRLM

ygfX

Inner membrane protein YgfX

135 amino acids

A probable inner membrane protein. Has been shown not to be a toxin, no effects on growth are seen in LB or minimal medium up to 6 or 21 hours (respectively) after induction of expression (PubMed:23657679). Interacts with cytoskeletal proteins FtsZ and MreB; inhibits FtsZ GTP-dependent polymerization as well as MreB ATP-dependent polymerization (PubMed:22239607). Restores production of prodigiosin antibiotic (Pig) in Serratia strains with deletions of sdhE-ygfX; overexpression of this protein and CptB also restores Pig production to a slightly lesser extent in Serratia (PubMed:22474332).

16.064 kDa

MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR