Protein
Transcriptional coactivator YAP1-A
Function
Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (By similarity). Required for expansion of the neural plate and neural plate border zone progenitor pools. Acts as a direct regulator of pax3 expression via interaction with tead1 (PubMed:21687713).
Similarity
Belongs to the YAP1 family.
Sequence
MEPGSQQQPSAPAQQPPPVGHQVVHVRTDSETDLEALFNAVMNPKNANLPQTLPMRMRKLPDSFFKQPQPEAKSHSRQASTDGGSAGALTPQHVRAHSSPASLQLAAVSPGALSPQGVVTGLAPPSAPHLRQSSYEIPDDVPLPPGWEMAKTPSGQRYFLNHIDQTTTWQDPRKAMLSQINVTAPTSPPVQQNIMTPTGPLPDGWEQALTPEGEAYFINHKNKSTSWLDPRLDPRFAMNQQRLSQNAPVKAPPALPPPSPQTGVLGSGGNQQMRLQQLQMEKERLRLKHQELLRQVRPQELALRSQIPPMEQDGGTQNPVCTTGISQELRTMTMNSSDPFLNSGTYHSRDESTESGLSMSSYSVPRTPDDFLNSVDEMDTGEAITQSTIPTQQNRFPDYLETLPGTNVDLGTLEGEAMNVEGEELMPSLQEALSSDILNDMETVLAATKLDKESFLTWL