whiB4

Transcriptional regulator WhiB4

118 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity).

Belongs to the WhiB family.

13.211 kDa

MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG

whiB4

Transcriptional regulator WhiB4

118 amino acids

Redox-responsive transcriptional regulator that regulates a set of genes involved in protection against environmental stresses encountered during infection. The loss of the O(2) and NO-responsive 4Fe-4S cluster and subsequent redox modifications of Cys residue thiols (possibly by disulfide bond formation) may activate its role in gene regulation. The thiol-oxidized apo-form binds in a sequence non-specific manner to GC-rich DNA, probably in the minor groove. Represses transcription of a number of genes including itself. The reduced apo-form and holo-form do not bind DNA. The apo-form can act as protein disulfide reductase.

Belongs to the WhiB family.

13.211 kDa

MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG

whiB4

Transcriptional regulator WhiB4

116 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity). Plays a role in lipooligosaccharide (LOS) biosynthesis by regulating LOS gene expression.

Belongs to the WhiB family.

13.016 kDa

MSGIRPVDGRANLTSAQNLLSTGEAEERINWVSKALCRATDPDELFVRGAAQRKAAVICRHCPVMQECGADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYFEKRKRRSVG