About Services Proteins Contact

wdr53

Gene
wdr53
Protein
WD repeat-containing protein 53 homolog
Organism
Dictyostelium discoideum
Length
368 amino acids
Similarity
Belongs to the WD repeat WDR53 family.
Mass
41.988 kDa
Sequence
MTSVDINNNNNNNNNSNSNIIETKLIGHKDTVLCISSHNKKEIIASGSDDCTVRIWDLNTNKSIQSIVEGFQGNPVNNVCFDQDFTLYCSYDNIIVSFDLRQPNVILKEFNTQYKFNTEEINQLSFDSKYQYLAACDDSGQTKIIDVTKNKLVESLNKKHTNIATGCVFRPNSKNELITSSMDFSIIHWDFLKAKVLHRDTFKEGSLPQNISKSQQQQQETTEPNRMLNPPFVTSVDCSNNSKYVAISMGDGTIVINEISSFKQYLKINSIHKSSIQQVHYPKYLENNYQRLISFGNYDKKIVIWDVSEDMNTKVSSSLLSNDEKNNERIKTWLEHSEKINCLTTSNLKNNAIFVADLSNDLKLLSIQ

Gene
WDR53
Protein
WD repeat-containing protein 53
Organism
Homo sapiens
Length
358 amino acids
Similarity
Belongs to the WD repeat WDR53 family.
Mass
38.989 kDa
Sequence
MAVKWTGGHSSPVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHSISVASCGNIFSCGAEDGKVRIFRVMGVKCEQELGFKGHTSGVSQVCFLPESYLLLTGGNDGKITLWDANSEVEKKQKSPTKRTHRKKPKRGTCTKQGGNTNASVTDEEEHGNILPKLNIEHGEKVNWLLGTKIKGHQNILVADQTSCISVYPLNEF

Gene
Wdr53
Protein
WD repeat-containing protein 53
Organism
Mus musculus
Length
358 amino acids
Similarity
Belongs to the WD repeat WDR53 family.
Mass
38.642 kDa
Sequence
MAVKWTGGHSSSILCLNANKDGLVASGGEGGDLVAWGEDGTPLGHMQLEGADDVTSVLFSASCPTKLYASHGETISVLDVRSLKGSLDHFHVNEEEINCLSLNETESLLASADDSGAIKILDLEKKKVTRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPVWITNLQEDETEETEGPQTPGRLLNPALAHSVSVASCGNIFSCGAEDGKVRIFRVMGVKCERELGFKGHTLGVSQVCFLPESSLLLTGGNDGRIRLWDVSGKMEKLQKSPARHIHRKKAKRAACPTQGGNSRAPGAEDEGHAKILPKLDIEHGEKVNWLLSTKIKGNKSILVADQTSCVSVYPLNEL

Gene
WDR53
Protein
WD repeat-containing protein 53
Organism
Bos taurus
Length
358 amino acids
Similarity
Belongs to the WD repeat WDR53 family.
Mass
39.242 kDa
Sequence
MAVKWTGGHSSPILCLNASQEGLVASGAEGGDLVVWGEDGTLLGHTCFQGAEDVTNVLFSPSCPTKLYASHGETISILDVRSLKEPLDDFHVNEEEINCLSLNETENLLASADDSGTIKILDLENKKISRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQVMLWNLRKARPLWITNLQEDETEEMESPQSPGQLLNPALAHSVSVASCGNVFSCGAEDGKVRIFRVMGVKCEQELGFKGHSLGVSQVCFLRESYLLLTGGNDGKIKLWDVSSEIEKKHKSPTKHTHRKKTKRAAYTKQGGGTHASVTGEDEHGKILPKLSIEHGEKVNWLLSTKIKGYRNILVADQTSCISVYPLKEF