veA

Developmental and secondary metabolism regulator veA

611 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (PubMed:22227160). Controls the expression of the dothistromin gene cluster (PubMed:22227160). Regulates hyphal growth and pigment formation (PubMed:22227160). Acts as a positive regulator of virulence (PubMed:22227160).

Belongs to the velvet family. VeA subfamily.

67.573 kDa

MNRKTHIPVENETKSSATRTTNDGRAITYEMQVLQQPQRARACGQGAKSSADRRPVDPPPIVELKIFEGEKRDDITYTMHANYFLFATLEQARPIAHARGQDRNTHPVLTGTPVAGMVYLDRPTPAGYFIFPDLSVRHEGEYRLSFSLYEELKNPKDEDKPEEACDAAGGDAHVTHRLEVKSAPFHVYSAKKFPGLTESTHLSRMVAEQGCRVRIRRDVRMRRREPKSGGKDWDEYEEDTAAARARASATPDPSINGYMQTPHGFIEPNPRPRSASNASHQSLGSISRRPSMQEMGQAYHQQPHYGTAPHTPQNGYTQTAPYGPPPGQQYPPNQFVQQQPPMQPPLPQYQPPNYPAPPPPVTAAQQPQPAQSYYNYPAAPPPPQATQVQQYNVSAHAYDSGVQSHRPSIDFPAQDGYRRNSQQIPPTSQPTAYTQPMQPQYAAQMPPAQHYQQPPPPPPSQASQHSSYSSMDLYNSRPAPIEPHHHGNTPASKASFDLPPINTAAMVSNKLEASSPTSVAPTNAYFSGGQTPIDTHKRSYGDVFSNRHHNAPLRQGQRPSYGQGDSLVTGTTMSAADDDDNASSELDPSTLGMHYRRADGRQIQRALPGHA

VEA

Developmental and secondary metabolism regulator veA

594 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex acts as a global regulator for secondary metabolite gene expression (By similarity). Regulates of the response to reactive oxygen species (ROS) stress (PubMed:24632440).

Belongs to the velvet family. VeA subfamily.

66.832 kDa

MKASTDHHVSGPPPVMIERVTRGGRRLFYRIDVIQQPEKCRACGSGPKSSTDRRPVDPPPVVELRIFEGPRFEEAKDITFTYNANFFLFATLEKARPMAHGRVTGPVVDAPPVLTGMPVSGMAYLDRPIEAGYFLFPDLSVRHEGTYRLSFNLYEETKDDRDKDMEPDEPSSEPQGFFYHRMEIKSADFACFSAKKFPGLGLSTPLSMTMAEQGTRVRIRRDVRMRRRDGKPSSGGGDFSSNSNNNAEDEAARRRRTRTPEPPAREDLRRSLSGTGDAPARNPEPQRRPSAADYRAPPPPNPPPPGFPSAQVPATSHLTFGGAPYGSHSQYQQPTSSSSSSEQVSSVPQSPAYSSHAAQQHYGQAPQPPTPTYPERRLSDHRSSQPNNHPQQSPHQHSYSHRSSPQRERFMPDSRRPSAPSHSHILSARPMTPQSANELRRPSDYNRPIPPPTDVLVADTQATPHLPPIRWPRPNMNLPSPPSEHQEALQPLQPAPLHYESQTHQQQLGGRKRTHDSYEEHSYSYGYSYSHNHSHGYGPTPSARPPAKNRKRPEDVEEKYTVTETMVVDRPEQFFPKPLKYVWTQCRAEPPPRE

veA

Developmental and secondary metabolism regulator veA

574 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (PubMed:16988822, PubMed:26209694). Controls the expression of the cyclopiazonic acid, aflatrem, and aflatoxin gene clusters (PubMed:16988822, PubMed:17646985). Controls the expression of the sclerotium-specific pigment asparasone A gene cluster (PubMed:16988822, PubMed:17646985). Controls the expression of the aflavarin gene cluster (PubMed:26209694). controls also the production of hydrolases and other extracellular proteins during growth on natural starch-based substrates (PubMed:24584515). Regulates genes involved in the High Osmolarity Glycerol (HOG) signaling pathway (PubMed:24951443). Required for the conidial and sclerotial density-dependent production (PubMed:23994319, PubMed:24412484).

Belongs to the velvet family. VeA subfamily.

63.034 kDa

MATRAPLAPPPNETEASVSRITREGKKLTYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRVYESDPNDDLNKTDITFAYNANFFLYATLETARPMAQGRFAPNPTCPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGVYRLNFHLYEETKESKDANENAPIQSMSNPMPSKPMAPKSFLEFRLEVVSVPFTVFSAKKFPGLATSTSLSRVIAEQGCRVRIRRDVRMRRRGEKRTDDYDYDEERVYRSSDRISTPDTHGYAGTPVERPRSTSTSTVDPSFPYGVDAQRRSSGATEYGFQGAQPYQRPLPPAPGPAPAAVSTPAPPAPPAPPSHNPGYQSHLSFGSTQTQYPAPQLPPTPQTASTLAAPYSPHPSYSHARNPSTSAEYETPGYSYPPSRMSTERSSYPKNGLPPLRLEPPKPLNMPSGEPRSSDPNAYHSVAQSAAPRSQTPSSSLVPSLPPLKALSGDYPNNLSQSSSSTSQSPSHDLGAGKKFFWDTGASLSKRSYEDSFGHDDRPLYNGMRPDTESYPRRLSDASRNFYNETRDEMAYKRANGRMATKISPALQ

veA

Developmental and secondary metabolism regulator veA

574 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (PubMed:20541108). Controls the expression of the penicillin gene cluster (PubMed:20541108).

Belongs to the velvet family. VeA subfamily.

63.016 kDa

MATRAPLAPPPNETEASVSRITREGKKLTYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRVYESDPNDDLNKTDITFAYNANFFLYATLETARPMAQGRFAPNPTCPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGVYRLNFHLYEETKESKDANENAPIQSLSNPMPSKPMAPKSFLEFRLEVVSVPFTVFSAKKFPGLATSTSLSRVIAEQGCRVRIRRDVRMRRRGEKRTDDYDYDEERVYRSSDRISTPDTHGYAGTPVERPRSTSTSTVDPSFPYGVDAQRRSSGATEYGFQGAQPYQRPLPPAPGPAPAAVSTPAPPAPPAPPSHNPGYQSHLSFGSTQTQYPAPQLPPTPQTASTLAAPYSPHPSYSHARNPSTSAEYETPGYSYPPSRMSTERSSYPKNGLPPLRLEPPKPLNMPSGEPRSSDPNAYHSVAQSAAPRSQTPSSSLVPSLPPLKALSGDYPNNLSQSSSSTSQSPSHDLGAGKKFFWDTGASLSKRSYEDSFGHDDRPLYNGMRPDTESYPRRLSDASRNFYNETRDEMAYKRANGRMATKISPALQ

veA

Developmental and secondary metabolism regulator veA

574 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (PubMed:15294809). Controls the expression of the aflatoxin gene cluster (PubMed:15294809, PubMed:19889978). Required for the expression of aflR and aflJ (PubMed:15294809). Mediates the coordination of aflatoxigenic vesicles (aflatoxisomes) development with aflatoxin gene expression (PubMed:19889978). Regulates branched chain amino acid and ethanol metabolism and acts as a positive regulator of mitochondrial and peroxisomal beta-oxidation (PubMed:20735852).

Belongs to the velvet family. VeA subfamily.

62.948 kDa

MATRAPLAPPPNETEASVSRITREGKKLTYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRVYESDPNDDLNKTDITFAYNANFFLYATLETARPMAQGRFAPNPTCPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGVYRLNFHLYEETKESKDANENAPIQSMSNPMPAKPMAPKSFLEFRLEVVSVPFTVFSAKKFPGLATSTSLSRVIAEQGCRVRIRRDVRMRRRGEKRTDDYDYDEERVYRSSDRFSTPDTHGYAGTPVERPRSTSTSTVDPSFPYGADAQRRSSGATEHGFQGAQPYQRPMPPAPVPAPVAVSTPAPPAPPAPPSHNPGYQSHLSFGSTQTQYPAPQLPPTPQSASTLAAPYSPHPSYSHARNPSTSAEYETPGYSYPSSRVSTERSSYPKNGLPPLRLEPPKPLNMPSGEPRSSDPNAYHSVAQSAGPRSQTPSSSLVPSLPPLKALSGDYPNNLSQPSSSISQSPSHDLGAGKKFLWDTGASLSKRSYEDSFGHDDRPLYNGMRPDTESHPRRLSDAGRNFYNETRDEMAYKRANGRMATKISPALQ

veA

Developmental and secondary metabolism regulator veA

573 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (PubMed:12223191, PubMed:2253875, PubMed:2076818, PubMed:14665453, PubMed:18556559, PubMed:19210625). The velvet complex acts as a global regulator for secondary metabolite gene expression (PubMed:18556559). Controls the expression of the sterigmatocystin and penicillin gene clusters (PubMed:14665453, PubMed:17375284). Represses the cryptic ors gene cluster producing orsellinic acid and its F9775 derivatives in a laeA-independent manner (PubMed:23841751). Required for full induction of faoA gene expression by fructosyl amines (PubMed:12375102). Positively regulates the expression of the early sexual development gene esdC (PubMed:17977758). Controls the expression of mannoprotein mnpA (PubMed:12620259).

Belongs to the velvet family. VeA subfamily.

63.113 kDa

MATLAAPPPPLGESGNSNSVSRITREGKKITYKLNIMQQPKRARACGQGSKSHTDRRPVDPPPVIELNIFESDPHDDSNKTDITFVYNANFFLFATLEPERPIATGKLMTNQGSPVLTGVPVAGVAYLDKPNRAGYFIFPDLSVRNEGSYRFSFHLFEQIKDPKDATEGTQPMPSPVPGKLSSPQEFLEFRLEVISNPFIVYSAKKFPGLTTSTPISRMIAEQGCRVRIRRDVRMRRRGDKRTEDYDYDNERGYNNRRPDQYAGSDAYANAPERPRSTSISTNMDPYSYPSRRPSAVEYGQPIAQPYQRPMASTPAPSSTPIPAPIPMPGPVALPPSTPSPASAHAPAPPSVPLAAPPPLHTPSYQSHLSFGATQTQYPAPQLSHIPQQTTTPTHPYSPRSSISHSRNQSISEYEPSMGYPGSQTRLSAERPSYGQPSQTTSLPPLRHSLEPSVNSRSKTPSNMITSLPPIQSLSELPSTTSQPSSAIGSSPANEPGPRLWETNSMLSKRTYEESFGHDDRPLYNGMRPDSESYPGGMQRRPSYERSSLLDGPDQMAYKRANGRMVSKPATMR

veA

Developmental and secondary metabolism regulator veA

570 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (By similarity). Controls the expression of hundreds of genes, including those comprising more than a dozen known secondary metabolite gene clusters (PubMed:24116213). Controls the expression of the gliotoxin gene cluster (PubMed:23087369). Controls the expression of the fumagillin, fumitremorgin G, fumigaclavine C and glionitrin gene clusters (PubMed:24116213). The regulation of the fumagillin gene cluster and fumagillin production is performed through direct control of the expression of fumR (PubMed:24116213). Negatively regulates conidiation (PubMed:22970834, PubMed:23087369). Required for normal protease activity (PubMed:23087369).

Belongs to the velvet family. VeA subfamily.

63.032 kDa

MATRPPLMPPANETESSVSRISREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFESDPNDDLHKTDITFAYNANFFLFATLETARPMAQGRLTGPPTCPVLTGVPVAGVAYLDRPQQAGYFIFPDLSVRHEGRYRLSFHLYEEIKDIKDADKDTPMPDLNSSTNLTKPSAPKAHLNFRLEVKSVPFTVYSAKKFPGLATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERAFATRSDRYTTPDMYAANSAERARSTSISTTADTSFPYGSDAQRRPSAGDYGFQGAQPYQRSMPAASAAPAPAPVHSPATSAQTSSYQSHLSFGATQSQYPAPQLPPTPQSATPTNTYSPHPSYSHSRNPSNGTEYDATSSGYPYPQPRLPADRPSYSKAALPPLRLEPPKAPNMQTSTDSRSSDANAYPTLSQPPVPRAPTPANHVTSLPPLKVLSGEYSHPSQPNAQSPHHDLGSGKRLLWETNHTLSKRSHEETFGSDERPLHNGMRPDMDQYPSMGRKQPDYGRLPFYTDSRDEMAYKRANGRMVMKILPALP

veA

Developmental and secondary metabolism regulator veA

555 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (By similarity). Increases spore dispersing capacity by impacting conidiophore architecture (PubMed:25367340).

Belongs to the velvet family. VeA subfamily.

61.318 kDa

MATRPPLSPPVNETEHSVSRITREGKRITYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFESDPNDDVHKTDITFAYNANFFLFATLETARPMAQGRLAPTPTFPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGIYRLSFHLYEETKDSKDADESAPIRSPMMKGKPSIPKSFLNFRLEVVSVPFTVFSAKKFPGLTTSTSLSRIIAEQGCRVRIRRDVRMRRRGDKRSDDYDFDEERSHRGRIPDRYSTPDAYANPVERPRSTSIGSVDPAFSYGPEASRRPSATEYGFSNPQAYPRAIPPAPAPAPPSSSTPTPVAPIAPSRSSSYTSHLSFGATRTQYPAPQLPGTPQSATTPTQVYSPHPTYTHARNPSTSTEYEPMPSGYPPSRLPAERSTYSKPLPPIRVLHHSDPTTYRAMANPVPPRAQTPSNAAPSLPPIASISAEYSNNLPQPPSNLAPSPNREPRGFLWDTRAAASSKRPHEDAFSHSERPLYNGMRPDNDSYPSADRRPSDVHRATLLSDRDEMAYKRANGRMATKISPAI

veA

Developmental and secondary metabolism regulator veA

532 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (By similarity). Controls the biosynthetic gene cluster for beauvericin, a depsipeptide mycotoxin that functions as a virulence determinant (PubMed:23106229). Regulates also chromatin structure and transcription of siderophore biosynthetic genes and is required for infection of tomato plants (PubMed:23106229). Governs expression of nitrate metabolism genes (PubMed:24240057).

Belongs to the velvet family. VeA subfamily.

59.293 kDa

MATPSSIPAEPKRDVINRIHRVTRENRSLWYQMTVLQQPERARACGSGSKANSDRRPVDPPPVVELRIIEGPSVEEGKDITFDYNANFFLYASLEHARPLARGRVNTPAAGNPPILTGVPASGMAYLDRPTEAGYFIFPDLSVRHEGLYILTFSLFETTKEERDYDLEPADGDLPPGVDYRMEIKTEPFSVYSAKKFPGLMESTQLSKTVADQGCRVRIRRDVRMRKRESKPGAGNSNSGGNGFERREEDFSRRRTITPASEDPHSIRNRSHSNSSEHRTPYTDASRRPSMVDSYPPPPPPPPPSYEPAPSASRHLDFGDSSAAQYPTPRQYAHQPGLQITPGPPNGSYAPTAQSPYSKTDVPYGYVNRNIPPSCPSPAPSLKHELYDRRQSTSTYVPPSPSVYSTEGHHRRDSRPSYPPTPVAAPHPRPMHSQTSLPALKIDQLVSPVSPLPPIEPQTGPAPELPPINVGGKRKHESVFAQSTRPLHNGQRQVDPHYGRSHRGYSPDHDQGWYSRADGQISSVQFNRYYDE

veA

Developmental and secondary metabolism regulator veA

514 amino acids

Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (PubMed:17400783). Controls the expression of the cephalosporin C gene cluster (PubMed:17400783). Regulates hyphal fragmentation (PubMed:17400783).

Belongs to the velvet family. VeA subfamily.

57.247 kDa

MATPSLIPTDADRDHPVRIHRVTRTNRHLWYQLTVLQQPERARACGAGTKDSDRRPVDPPPVVELRIKEGNSFEEGKEITFDYNANFFLYASLEQSRRIAPGRMQGQPNPPILTGSPVSGMAYLDRPAAAGYFIFPDLSVRHEGHYRLSFSLFETTKDEKDLDIERASDDRLDTGADWRMEIKTSPFDVFSAKKFPGLMESTPLSKEVADQGCHVRIRRDVRMRKRDAKSNNGRDRREDDMARRRTVTPASEDPHSAAARARSMSNSSEHRVPGPPEPPGHPSAVDPAGRGHLSFGGPQYASPHQYGLQSRLPPPSPGGPYNPATQYIKPEHQSYRYPPSRDMSQTGPSPAPRQDGHDRRQSGPYVPPSPSVYSNDGRSRPESHPSYPSTPVSSHPANLPSDPSLVLPRIKSPSNSVSPSNSSLKITDLLVQPLPSSEPKLEVGSAPCPPPKTPIGSKRKHDQTFVQNDRALRNHQRQLDPHYNPVARPCSPVGEQYKRADGTYMYAKFSVFTM