Function
Ubiquitin-binding protein which acts as an adapter for ATPase cdc-48.1 and/or cdc-48.2, conferring substrate specificity (PubMed:20977550). Together with ubxn-2 and ubxn-3, plays a role in hermaphrodite spermatogenesis probably by promoting the degradation of sex determination terminal factor tra-1 (PubMed:20977550). Probably in association with ATPase cdc-48.1 or/and cdc-48.2, regulates the centrosomal levels of kinase air-1 levels during mitotic progression by promoting air-1 removal from centrosomes in prophase (PubMed:23649807). Also, regulates spindle orientation in the one-cell embryo by controlling centration and rotation of the pronuclei-centrosome complex in prophase (PubMed:23649807).
Sequence
MSRNIRTFRDIGNNDDGGPDSDDSGADAAERGAPQEFYAGSGQAVQGPRGAAARGPDSEAHIRRILQAAEVVQPEGGEAPRGRPSGRETISLTLHLWSDGLSIEDGPLMSRQDPRTIEFLESVGKGEIPPSLVQQYPGKEIDFKVNRHHEEYVAPKMKPFGGSGVRLGNVVPTVLGQSSSSATTAGTSSATTDHNPDHTAENEAKQLEDAKKELSTNMNEPTTNIQIRLPNNQRLVGIFNHSHTLEAVRTFICTARPDMIYAPFQMMAAYPPKPFEDESQTLKDANVLNSVVAVKILPTTN