ttm3

Mitochondrial import inner membrane translocase subunit TIM50-A

343 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the TIM50 family.

40.58 kDa

MHKIVWFGTLNKSIGYIGKKKTCLLSPCEKICLNSARKTVQRCDKNYSPPKLRRIKNFYTYSVVLGSLFSIVMWAIYKLGKPEEDHRGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLPTSERQWNLTLLGRSLRGSSIK

TTM3

Triphosphate tunnel metalloenzyme 3

210 amino acids

Involved in the hydrolysis of the beta-gamma-phosphoanhydride linkage of triphosphate-containing substrates (inorganic or nucleoside-linked). Catalyzes the hydrolysis of inorganic triphosphate (PPPi), however it does not display significant activity towards long-chain polyphosphates. The existence of PPPi in living cells is still unclear, and PPPase activity might be the ancestral function of CYTH domain. It also has gamma-phosphatase activity on NTP substrates, but no adenylate cyclase or RNA triphosphatase activity.

24.163 kDa

MEVEVKLRLLTAAAHLRLTTLLTPYHLKTLHQRNTFFDTPKNDLSLRRAVLRLRFLQNAAVSAASPSPPRCIVSLKAKPTLANGISRVEEDEEEIEYWIGKECVESPAKLSDIGSRVLKRVKEEYGFNDFLGFVCLGGFENVRNVYEWRGVKLEVDETKYDFGNCYEIECETEEPERVKTMIEEFLTEEKIEFSNSDMTKFAVFRSGKLP