About Services Proteins Contact

tppp-1

Gene
tppp-1
Protein
Tubulin polymerization-promoting protein homolog
Organism
Caenorhabditis elegans
Length
180 amino acids
Similarity
Belongs to the TPPP family.
Mass
19.406 kDa
Sequence
MAAAAGFNWDDADVKKRWDAFTKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKVLAFVAEDRARQSKKPIQDELDAITEKLAKLEAPSVGGAAKANAAGVYSRLTDHTKYTGAHKERFDAEGKGKGKSGRADTTENTGYVGAYKNKDSYDKTHGK