About Services Proteins Contact

tipE

Gene
tipE
Protein
Protein tipE
Organism
Drosophila melanogaster
Length
452 amino acids
Function
Enhances para sodium channel function. Required during pupal development to rescue adult paralysis and also protects adult flies against heat-induced lethality.
Mass
50.19 kDa
Sequence
MGDEQDKRTGKEKLLFYTTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYYGAKNCSWSSCREGCTKDIYTCTQIRVNYRLNLYNFTDEFNFTEYHINLKEAERILPPVKRTDRYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISDERRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRYTKIGMKFPCYYSKVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAYFKIYNEDEETAPLDKNAEDMDIDDIDAVDDSDGAVLADNVAGSQIINMDSTTNDSCLEGVLPNGGPGMTASISQGGSVTTPGPYIAQSPAGSQMTPNSEINSFGHQLKVQMADELSRDSLENGAISTSNSVQGNLSKTMTTSISTPPGPTAAV