Function
Trans-enoyl reductase; part of the gene cluster that mediates the biosynthesis of tellinin that could be linked to insect pathogenicity (PubMed:17216664, PubMed:18266306, PubMed:20575135). The polyketide-amino acid backbone is first assembled by the PKS-NRPS hybrid tenS (PubMed:17216664, PubMed:18266306, PubMed:20575135). Because tenS lacks a designated enoylreductase (ER) domain, the required activity is provided the enoyl reductase tenC (PubMed:18266306). Upon formation of the polyketide backbone on the thiotemplate, the triketide is transferred to the NRPS module and linked to tyrosine to produce the acyltetramic acid intermediate called pretenillin A (PubMed:18266306). The cytochrome P450 monooxygenase tenA catalyzse an oxidative ring expansion of pretenellin A to form the 2-pyridone core of tenellin, leading to pretenellin B (PubMed:19067514). The cytochrome P450 monooxygenase tenB is then required for the selective N-hydroxylation of the 2-pyridone nitrogen of pretenellin-B to yield tellinin (PubMed:19067514).
Sequence
MAAISSPPLTQKALKVASPDTLHLVTDAPLPTLGQDDSVLIRVVCVAINPVDGKSAEMSPTPGATSGTDFAGIVVALHGDAKSRTETADTIKTGDRVMGFVFGNNPHVLGNGAFAEYVTLPRRFLWRVPDHMSLEAAASLPVGVASVGMALHYLRISMSSLLKAVSRSIAAPSASQPHDGAFDSDANVFILVYGGGTSTGAIAIQILKAAGFHPITCCSSESASRAKRLGAVATFDYQSATCGRDIRDYTNDSLTLAIDCLSESASMAICYEAMGSAGGRYVSLDPFPVRGCVRRSIVPDWICSFTQFGQSIPWAPPYNLDERPDDHRLAEEWYHLAQKLLDAELIEAPTLEIRSGGLLHVPEGVAAVKLGQIKRRKLVYHISEEALP