sra-13

Serpentine receptor class alpha-13

335 amino acids

Chemosensory receptor that negatively regulates RAS/MAPK signaling during vulva induction and the negative regulation of olfaction of volitile attractants. Required for the suppression of vulval induction in response to food starvation. Signaling acts through the GPA-5 G-alpha protein subunit (By similarity).

Belongs to the nematode receptor-like protein sra family.

38.392 kDa

MAIVSSENRTCADEKLLALYQSWSYIASIVFNCLVPTISTYFLGRAIFQLCNQATIQYSTRILLIATILFAACHQVSYFAFKIDLLHTMFFKLDQPCFLQRSSYDCRFISIAQTTGVVGMALTGLAMSTDRALALTFPADYHKLKSVPRVVLSVFVFIVSFSTWFLLTMNDPLTGYLNHCGFYPSYSVANFQLMLDVILYLAIFNLIWDVILFYYARQQILWRRSYQFQKRYEARISLNCTQAVFVISICQCISNGANSGLMRLLMMIGTSITSVTYSSLLSLFYTAPYSCILLPILMMRISEYIREQRTIGILSLRSEKPGLEEHHQRMRAAWS

sra-13

Serpentine receptor class alpha-13

335 amino acids

Chemosensory receptor that negatively regulates RAS/MAPK signaling during vulva induction and the negative regulation of olfaction of volitile attractants. Required for the suppression of vulval induction in response to food starvation. Signaling acts through the GPA-5 G-alpha protein subunit.

Belongs to the nematode receptor-like protein sra family.

38.522 kDa

MAIISSVNRTCASESLLELYRSYKYILSTSFNIIIPIISLFFLVYAIKQLCAQSIIQYSTRVLLITTILFAVCHQIAYFCFKADLLYTMLFKLDQPCNLQHSSYDCRFITIATTTSNCGMALVQLAMSIDRVFALKFNRVYYKLKSIPGITLALITLSISFSMFFILTIDDPLSGYVNHCGFYPTYSQDKFHIFLDVTLYLAVFNFVFDIGLMYYSYQEILWKRSYSFVNRFQSRISLKCTQAIFIISICQCISNVLYSGLLSLLMKLGRYMSSADYNLSLSLAYTTPYSCLILPILICKVLEYIKKQRTVGILSLRNQKQSMEGHMAMINSAWK