slx-1

Structure-specific endonuclease subunit SLX1 homolog

443 amino acids

Catalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA (Potential). Has a preference for replication forks over 5' flap structures or Holliday junctions and shows much lower activity toward 3' flap structures (PubMed:22927825). Required for proper crossover distribution through inhibition of crossover formation at the central region of chromosomes (PubMed:22927825, PubMed:23874210).

Belongs to the SLX1 family.

50.536 kDa

METFILSSDSDDDSGPPPSKRRTIEGIPRSFSGDKKIRFSFGASNMSQDTTQEIIPEDTDTVPLTIPSTPALSGKFDSKTPKSVRRRSVSMSCFTPIVETINQPPTNQACSSFLQKEYNFHDLSSDEEGGDGGAGCSKDEDKIIEDNLNLRALLSPEKKKRKEKIEEVQNEFYGVYCLISRSDRPCYKNRCYIGYTVDPNRRIMQHNGGRDKGGAKKTDSRGPWDMVCVVHGFPNHVAALHFEWAWQNPLVSKSLKEKQLRKERKETPFAFQLRIACELMNSSAFCRFALTFRWLITTEELPFPTSCVPPDHTKLRFGKVKKEMSLVPSKREDYLEMGECRICGKDIEKLWSLVRCISATCPSHFHSKCLSENGLKLKNEHVDHVYPLKANCPTCGQFYLWGDIIREQRRIIKISTKCAEEFQNMVVRKELPHREISPISSKK

slx-1

Structure-specific endonuclease subunit SLX1 homolog

439 amino acids

Catalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA (Potential). Has a preference for replication forks over 5' flap structures or Holliday junctions and shows much lower activity toward 3' flap structures (By similarity). Required for proper crossover distribution through inhibition of crossover formation at the central region of chromosomes (By similarity).

Belongs to the SLX1 family.

50.886 kDa

METFILSSDSDDDCPPPPKRRSIEGVPKSFDGDKKMRFSFDVTRDIILEDSEAPCSSNNIFTPSFRRDSNKTLLKTPVSLRRRSRSMNCMTPIVDTINEPPINQVCSAFVQKEIQLDDDDDDEKESSTEHADDDLNLRALLSPEKKKRKEKVDKRRPFGVEEVQNEFYGVYCLISRSERQCYKNRCYIGYTVDPNRRIMQHNGGRFKGGAKKTDSRGPWDMVCVVHGFPNHVAALRFEWAWQNPAVSKSLKEKQLKKERKETPFAYQLRIACELMNSEAFSRFALTFRWLNTKEELPFPISCTPPNHVKLRYGKVKKEMSLVPAKSADYVAMGECRLCGKDIEKLWGLVRCISQSCHSHFHSKCLAEHGLKNKNEYADQIYPLKSNCPICGHFYLWGDVVREQRRIIKVSTKCAEEFRNKVVRKDLPHREISSRLRLKK