About Services Proteins Contact

sina

Gene
SINA
Protein
E3 ubiquitin-protein ligase sina
Organism
Schistosoma mansoni
Length
371 amino acids
Function
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates the ubiquitin-mediated degradation of nuclear receptors for retinoids SmRXR1 and SmRXR2.
Similarity
Belongs to the SINA (Seven in absentia) family.
Mass
40.584 kDa
Sequence
MNNSITEVNMSVPSRATNSNNTILSEERTCHRSQMASSDAVGRTMALLPINHNHALHHGIKLMPHINMPHREVGATTPLVTNSGTASTCSMSLPGSMSSASDTVCNILPHNTSDSSSIDLASLFECPVCMDYALPPIMQCQSGHIVCASCRSKLSSCPTCRGNLDNIRNLAMEKLASSVLFPCKYSTSGCPETFHYTSKSEHEAACEYRPYDCPCPGASCKWLGELEQVMPHLVHHHKSITTLQGEDIVFLATDISLPGAVDWVMMQSCFGHSFMLVLEKQERVPDQIFFALVQLIGTRKQADQFVYRLELNGHRRRLTWEACPRSIHDGVQSAIAVSDCLVFDSNTAHSFAENGNLGINVTISQVSPSIS

Gene
sina
Protein
E3 ubiquitin-protein ligase sina
Organism
Drosophila willistoni
Length
331 amino acids
Function
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons. Also involved in external sensory organ development.
Similarity
Belongs to the SINA (Seven in absentia) family.
Mass
34.964 kDa
Sequence
MSNKINPKRREPTAAAAAAVAAGVGGGVGGGASGVATANTNTTGSSSTGGSSSAGTTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV

Gene
sina
Protein
E3 ubiquitin-protein ligase sina
Organism
Drosophila erecta
Length
314 amino acids
Function
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons. Also involved in external sensory organ development.
Similarity
Belongs to the SINA (Seven in absentia) family.
Mass
33.707 kDa
Sequence
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV

Gene
sina
Protein
E3 ubiquitin-protein ligase sina
Organism
Drosophila melanogaster
Length
314 amino acids
Function
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk) (PubMed:9267026, PubMed:9267027, PubMed:11526076, PubMed:12215542, PubMed:18160715). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:12215542). Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons (PubMed:9267026, PubMed:9267027, PubMed:11526076, PubMed:12215542). Also involved in external sensory organ development (PubMed:11526076).
Similarity
Belongs to the SINA (Seven in absentia) family.
Mass
33.707 kDa
Sequence
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV

Gene
sina
Protein
E3 ubiquitin-protein ligase sina
Organism
Drosophila virilis
Length
314 amino acids
Function
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons. Also involved in external sensory organ development.
Similarity
Belongs to the SINA (Seven in absentia) family.
Mass
33.804 kDa
Sequence
MSNKINPKRREPTVAAAVAAATAVVATNTSSSTGSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEEVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV