SIGE

RNA polymerase sigma factor sigE, chloroplastic/mitochondrial

517 amino acids

Essential protein. Sigma factors are initiation factors that promote the attachment of plastid-encoded RNA polymerase (PEP) to specific initiation sites (e.g. psbA and psbD) and are then released. Essential for blue light-mediated transcription of psbD, which encodes the photosystem II reaction center protein D2. Plays a role in reproduction. Required during female gametophyte development (PubMed:21123745).

Belongs to the sigma-70 factor family.

58.813 kDa

MGVVSISSSAARSPLGLGNDLLTHRSSLKKPSIVAFKADDSSNSALIIPPREQVLIPAEKHNEKKREVTRRKPCKTPKKPLSLEHNSAPSCSLGVDYNEAAARLESIYKLSPATTTLVEDDVEDGGSKAKVSRRRKRKESGEEKKVVVRNNVKKEKRMSLDKRIALKRNVQEKPVVASVDKKVTKRQQEEEKIERLVRDYSASNDIVSLDWKKMKIPPVLSSTEHAWLFKLMQPMKALLEVKDVLQKSLGREPREAEIAGEINMTAGEVKKKIEIGRAARNKLIKHNLRLVLFVMNKYFHEFTNGPKFQDLCQAGMRGLITAIDRFEPKRKFRLSTYGLFWIRHAIIRSMTTSNFTRVPFGLESVRVEIYKAKTELWFEMGRPPTEDEVVERLKITPERYREVLRAAKPVLSLNSKHSVTQEEFINGITDVDGVGANNSRQPALLRLALDDVLDSLKPKESLVIRQRYGLDGKGDRTLGEIAGNLNISREMVRKHEVKALMKLKHQARVDYLRQYIV

sigE

ECF RNA polymerase sigma factor SigE

257 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

29.005 kDa

MEHDDRRASQVRAGNNRVVIRVEQIENNAVHEQEGSTTIASQPVTATHAAPVSMAHLEQFTDSDWVEPSDEPTGTAVFDATGDQAAMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRGRIRMEALPEDYDRVPAEDPNPEQIYHDSRLGADLQAALDSLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQQLRDYLAKHSSETAQSA

sigE

ECF RNA polymerase sigma factor SigE

257 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released. Responds to surface stress (H(2)O(2)) (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

28.877 kDa

MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR

sigE

ECF RNA polymerase sigma factor SigE

257 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

28.877 kDa

MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR

sigE

ECF RNA polymerase sigma factor SigE

257 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released. Responds to heat shock and surface stress (detergent exposure). When combined with isolated core RNA polymerase from M.smegmatis is able to guide initiation from the sigB promoter. Required for full expression of sigB, and for sigB induction after detergent exposure but not after heat shock. Controls a regulon of about 38 genes in culture (PubMed:11489128) and about 16 genes during macrophage infection (PubMed:18657035), most of which have decreased expression in a disruption mutant. Probably down regulates the host immune response to mycobacterial infection.

Belongs to the sigma-70 factor family. ECF subfamily.

28.877 kDa

MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR

sigE

RNA polymerase sigma-E factor

239 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of sporulation specific genes.

Belongs to the sigma-70 factor family.

27.652 kDa

MKKLKLRLTHLWYKLLMKLGLKSDEVYYIGGSEALPPPLSKDEEQVLLMKLPNGDQAARAILIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNNKIRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDIEANVDKKLLKKALEQLNEREKQIMELRFGLVGEEEKTQKDVADMMGISQSYISRLEKRIIKRLRKEFNKMV

sigE

RNA polymerase sigma-35 factor

239 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event (By similarity).

Belongs to the sigma-70 factor family.

27.636 kDa

MMKLKFYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV

sigE

RNA polymerase sigma-35 factor

239 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event.

Belongs to the sigma-70 factor family.

27.636 kDa

MMKLKFYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV

sigE

RNA polymerase sigma-35 factor

239 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event (By similarity).

Belongs to the sigma-70 factor family.

27.636 kDa

MMKLKFYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV

sigE

RNA polymerase sigma-E factor

235 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of sporulation specific genes (By similarity).

Belongs to the sigma-70 factor family.

26.97 kDa

MKFLLRLLSKLLCRIKLFSNRLYYIGGNDALPPPLSKDEEDDLVNKLVNGDESIRSILIERNLRLVVYIARKFENTGVGVEDLISVGTIGLIKAVNTFDPTKKIKLATYGSRCIENEILMYLRRNSKVKAEISFYEPLNIDWDGNKLLLSDILGTDNDCVYNLIEGEVDKQLLLFALKKLNEREKRIVELRYGLTGVGEKTQKEVADMLGISQSYISRLEKRIIKRLKKEINKML

sigE

RNA polymerase sigma-E factor

180 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is required for the synthesis of the antibiotic actinomycin.

Belongs to the sigma-70 factor family. ECF subfamily.

20.57 kDa

MAQGEVLEFEEIVRTRQDALLRTPPGLVPDPVDAQDLLQTALARTYGRWEGIADKRLADAYLRRVMINTRTEWWRARKLEEVPTEQLPDARVEDSTEQHADRALLMDAMKVLAPKQRSVVVLRHWEQMSTEETAAALGMSAGTVKSTLHRALARLREELETRDLDARALEREERERCAAA

sigE

RNA polymerase sigma-E factor

179 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is required for normal cell wall integrity; it is recruited by RNA polymerase to transcribe genes with cell wall-related functions (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

20.617 kDa

MAHGEVLEFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTALVRTYGRWDGIADKRLADAYLRRVMINTRTEWWRARKLEEVPTEQLPDASVDDSTEQHADRALLMDILKVLAPKQRSVVVLRHWEQMSTEETAAALGMSAGTVKSTLHRALARLREELESRDLDARALEREERERCAA

sigE

RNA polymerase sigma-E factor

177 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is required for normal cell wall integrity; it is recruited by RNA polymerase to transcribe genes with cell wall-related functions. It is also involved in the transcription of the dagA gene coding for an extracellular agar-degrading enzyme.

Belongs to the sigma-70 factor family. ECF subfamily.

20.493 kDa

MGEVLEFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTALARTYGRWETIEDKRLADAYLRRVMINTRTEWWRARKLEEVPTEQLPESPMDDATEQHADRALLMDVLKVLAPKQRSVVVLRHWEQMSTEETAAALGMSAGTVKSTLHRALARLREELVARDLDARALEREERERCAA

sigE

Chaperone protein SigE

113 amino acids

Molecular chaperone required for SopB/SigD stabilization and secretion.

Belongs to the IpgE/SigE chaperone family.

12.677 kDa

MESLLNRLYAALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDILTLQHFLRLNYASAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA

sigE

Chaperone protein SigE

113 amino acids

Molecular chaperone required for SopB/SigD stabilization and secretion.

Belongs to the IpgE/SigE chaperone family.

12.751 kDa

MESLLNRLYDALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDILTLQHFLRLNYTSAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA

sigE

Chaperone protein SigE

113 amino acids

Molecular chaperone required for SopB/SigD stabilization and secretion.

Belongs to the IpgE/SigE chaperone family.

12.709 kDa

MESLLNRLYDALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDTLTLQHFLRLNYASAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA

sigE

Chaperone protein SigE

113 amino acids

Molecular chaperone required for SopB/SigD stabilization and secretion.

Belongs to the IpgE/SigE chaperone family.

12.751 kDa

MESLLNRLYDALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDILTLQHFLRLNYTSAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA