siaP

Sialic acid-binding periplasmic protein SiaP

329 amino acids

Part of the tripartite ATP-independent periplasmic (TRAP) transport system SiaPT involved in the uptake of sialic acid. This protein specifically binds sialic acid (By similarity).

Belongs to the bacterial solute-binding protein 7 family.

36.439 kDa

MMKLTKLFLATAISLGVSSAVLAADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKASMKPYYAEFVKQTGQKGEAALKQIEAINP

siaP

Sialic acid-binding periplasmic protein SiaP

329 amino acids

Part of the tripartite ATP-independent periplasmic (TRAP) transport system SiaPT involved in the uptake of sialic acid. This protein specifically binds sialic acid with high affinity.

Belongs to the bacterial solute-binding protein 7 family.

36.513 kDa

MMKLTKLFLATAISLGVSSAVLAADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINP

siaP

Sialic acid-binding periplasmic protein SiaP

321 amino acids

Part of the tripartite ATP-independent periplasmic (TRAP) transport system SiaPQM that catalyzes unidirectional Na(+)-dependent sialic acid uptake. Binds the common sialic acid N-acetylneuraminic acid (Neu5Ac) with a high affinity.

Belongs to the bacterial solute-binding protein 7 family.

35.982 kDa

MKTINKITIAILTLSAAASVNAATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQQLTLGDLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTRETTSNRPLNSIEDFKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYLALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISESTWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPDLEPFREAMQPLYKEFDSNIGQPIVSKLAAM