About Products Protein Database Contact

sek-1

Gene
sek-1
Protein
Dual specificity mitogen-activated protein kinase kinase sek-1
Organism
Caenorhabditis elegans
Length
336 amino acids
Function
Dual specificity protein kinase which acts as an essential component of the p38 signal transduction pathway which is also composed of upstream effector nsy-1 and downstream effector pmk-1 (PubMed:11751572). May phosphorylate pmk-1 (PubMed:12142542, PubMed:16166371). Downstream of CaMKII unc-43 and adapter protein tir-1, plays a role in determining asymmetric cell fates in olfactory AWC neurons during neuronal development. Activation results in the repression of odorant receptor str-2 expression in one of the 2 AWC neurons (PubMed:11751572, PubMed:12142542). Involved in resistance to pathogenic Gram-positive and Gram-negative bacterial and fungal infection (PubMed:12142542, PubMed:18394898, PubMed:22216003). Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 (PubMed:20062796). Probably by promoting pmk-1-mediated activation of skn-1, involved in the up-regulation of gcs-1 and glutathione-S-transferase gst-4 expression upon bacterial infection (PubMed:22216003). Probably downstream of tir-1, required for the expression of antimicrobial peptide nlp-29 in the epidermis in response to fungal infection or physical injury (PubMed:18394898, PubMed:22308034). Regulates susceptibility of B.thuringiensis pore-forming toxin Cry5B and Cry21A (PubMed:15256590). Involved in the response to oxidative stress (PubMed:15888317, PubMed:22308034). May regulate transcription factor daf-16 localization during oxidative stress (PubMed:15888317). By phosphorylating pmk-1, regulates skn-1 localization during oxidative stress (PubMed:16166371). By phosphorylating and activating pmk-1, plays a role in the stabilization of transcription factor rnt-1 in the intestine during oxidative stress (PubMed:22308034). Up-regulates expression of gcs-1 in intestine upon arsenite treatment (PubMed:16166371). Regulates germline proliferation in response to osmotic stress, starvation and germline apoptosis induced by heavy metals, such as Cu(2+) (PubMed:16729024, PubMed:19497412). In association with mek-1, regulates germline cell apoptosis in response to oxidative, osmotic and heat shock stresses (PubMed:16729024). Plays a role downstream of tir-1/nsy-1 in regulating susceptibility to anoxia (PubMed:21212236). In males, by regulating pqn-41 expression, involved in non-apoptotic death of the linker cell which guides gonad elongation during larval development (PubMed:22363008). Involved in egg laying (PubMed:12142542).
Similarity
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Mass
38.7 kDa
Sequence
MERKGRERKLPGMKIVMPTPVETPTMNLEDRCLIKLTNESEEIEIAATDLVVLEELGKGGYGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLGITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELLAMPFMEQARNEKQFSMARFINEILDTVWRR