secB

Protein-export protein SecB

188 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

20.254 kDa

MADEQPQGNGQGAAQQGEQPKQQFQIAKLYLKDVSLETPNSPEVFTGEWKPQVNVDLTSKTRALQEGHYEVALTVTVTAKQGEKTAYLCEVTQAGVFQIKGFEDAARNGLLGAYCPAQLFPYVRETVNSLITQGGFPAMVLQPVNFDALYQQRLAQAAERQKAEQAQGGGAEAKGSDSTAAQGSDTQQ

secB

Protein-export protein SecB

178 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.419 kDa

MADEGDVLTDLDMDPAAGGNGADNRPTAGFITQYIKDMSVENPNAPGVYQWQEQPQIDLQFNIGANAVNEEVTEVELKINVEAKTDQGALYIIELVYAGLVGIRNLGDDQAHMFVYAEAPRILFPFARRVIADATRDLGFQPLMLDPIDFNGLYMQRLQQKAAEEAQGEGGETPAGDA

secB

Protein-export protein SecB

177 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.832 kDa

MSDENNSGAAAPEAQNPGQNAAQPAVRLQILTQYIRDLSFENAVAQKGLPSGEVQPEISVQVSLDARKRPAEHQYEVISKFRVQSSNATDKSPLFLCELDYGGIFHVEGVPEDQLHPFLMIECPRMMFPFVRRIVSDMTRDGGFPPFNMDPVDFVALYRQEIARRTQAQRPADQPLS

secB

Protein-export protein SecB

177 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.685 kDa

MSYKLKVKGQYIKDLSFENQNSPQIFVMISKTPPEINISVNVSSVSLPVKAQDQENGQSLDNKVEPLYEVTLQVNAEARVGTTVAFICEVKYCGVFSVENSDASNGEELSQQDMRDMLLISAPSILFPFVRELISRITATGGFPPLMLDVVDFKAMYESQIKQNAAEQNDNGQHTEK

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.992 kDa

MRYCRLGVSSMRPKLKVRGQYIKDLSFENPNSPKVFLMISKSPPEISISVNVSSASLPVKPTEGEQAAADLYEVTLQVNIESVVEKVPAFLCELKYCGVFSLEEKAEEQVVKEALLITAPGVLFPFVREVIAKMTASAGFPPLMLDVIDFEAMYASQLGGDDGKNKQANKSGGAA

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.992 kDa

MRYCRLGVSSMRPKLKVRGQYIKDLSFENPNSPKVFLMISKSPPEISISVNVSSASLPVKPTEGEQAAADLYEVTLQVNIESVVEKVPAFLCELKYCGVFSLEEKAEEQVVKEALLITAPGVLFPFVREVIAKMTASAGFPPLMLDVIDFEAMYASQLGGDDGKNKQANKSGGAA

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.082 kDa

MADQDQTNQQAGSDAPSFNLQRVYLKDLSLEMPNAPHVFLEQEAPQVEVSINVGGQRLAETVFESTVTVTVTTRVNDKVLYLVEGTQAGIFELANIPAEQMDPLLGIVCPTMLYPYLRANVADAITRTSLPALHLAEVNFQALYEQRLAEMAQQQPDAANGNDSGIILPPGATRQ

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.082 kDa

MADQDQTNQQAGSDAPSFNLQRVYLKDLSLEMPNAPHVFLEQEAPQVEVSINVGGQRLAETVFESTVTVTVTTRVNDKVLYLVEGTQAGIFELANIPAEQMDPLLGIVCPTMLYPYLRANVADAITRTSLPALHLAEVNFQALYEQRLAEMAQQQPDAANGNDSGIILPPGATRQ

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.055 kDa

MAEQDQNTQQAGGDAPSFNLQRVYLKDLSLEMPNAPHVFLEQEQPQVEVSINVGGQRLAETVFESTVTATVTTRINDKVLYLVEGTQAGIFELANIPAEQMDALLGIVCPTMLYPYLRANVADAITRTSLPALHLAEVNFQALYEQRLAELAQQQGGNNNGSDSGIILPPGTTRQ

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.082 kDa

MADQDQTNQQAGSDAPSFNLQRVYLKDLSLEMPNAPHVFLEQEAPQVEVSINVGGQRLAETVFESTVTVTVTTRVNDKVLYLVEGTQAGIFELANIPAEQMDPLLGIVCPTMLYPYLRANVADAITRTSLPALHLAEVNFQALYEQRLAEMAQQQPDAANGNDSGIILPPGATRQ

secB

Protein-export protein SecB

175 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.466 kDa

MSCKLKVKGQYIKDLSFENPNSPQIFLMISKTPPEINISINVSSVSLPVKAQDQSSEQPSDNKVEPLYEVTLQVNAEARVGTTVAFICEIKYCGVFSIESDDVSIEELSQQDIRDVLLISAPTILFPFVRELISRVTSTGGFPPLMLDIVDFRAMYESQMKQGVGQNDNSQDPEK

secB

Protein-export protein SecB

174 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.377 kDa

MSYKLDVKAQYIKDLSFENPNSPQIFVMMSKATPEINISVNVSSISLPVKTDDQKSGTENLSSLYEVTLQVNAEARIQNTVAFICEIKYCGVFSIKSDAENNEIDLSHQEVKDMLLVAAPSILFPFVRELIARATSSSGFPPLMLDIVDFRTMYENQLKQGVGQNDNDNSVDNV

secB

Protein-export protein SecB

174 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.377 kDa

MSYKLDVKAQYIKDLSFENPNSPQIFVMMSKATPEINISVNVSSISLPVKADDQKSGTENLSSLYEVTLQVNAEARIQNTVAFICEIKYCGVFSIKSDTENNEIDLSHQEVKDMLLVAAPSILFPFVRELIARATSSSGFPPLMLDIVDFRTMYENQLKQGVGQNDNDNSVDNV

secB

Protein-export protein SecB

173 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.639 kDa

MADEGNIISNLNLEDGPVPNGADTSPAIGLISQYVKDLSVENPNAPESYQWAEAPDMAVDFNISARAIQPEIHEIELKINVTSKGAQGTAFIVELAYCGLIGMRNVPDDQAHPFLFAEGPRILFPFARRIIADAVRDAGYPPLMLEPIDFNGLYMQQLAQAQATAEATPAGEA

secB

Protein-export protein SecB

173 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.144 kDa

MAENNGNGSTGAADTGQRQRFQIAKMYLRDVSFEAPGAPEAFRDEWKPQMDVELGTRHQPLGENTYDVVLTITVTARNNERTAYLCEVKQGGVFRLEGFPEADMERVLGAYCPAQLFPFAREAINDLVVKGGFPQLLLAPVNFESLYQQQKQRREQGTSDSAPSGSPDNGGRQ

secB

Protein-export protein SecB

173 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.908 kDa

MSDQQQQQPGQDGQPFFNIQRVYLKDLSLEQPNSPHIFLEQEQPTVEVQVDVAATQLAEGVFEVTVIGTVTTKVKEKVAFLVEAKQAGIFDIRNVPVEQMDPLLGIACPTIVYPYLRSNIADTIGRAGFQPIHLAEINFQALYEQRLASAMEEAQAAGGNGGIVMPDGSKATH

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.522 kDa

MADETSADINNPALQPNGEDTSPAIGLISQYVKDLSFENPNAPAVYQWQGAPQVDVQFNIAADSVGDNLYEVLLKIDVTSKTDKGTSFVIELKYAGLFGVRNVPDDQLQPFFLAEAPRILFPFARRVVADAVQDGGFPALLLEPIDFHGLFMQQVQAAQGEQVGDGAPVGQA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.5 kDa

MSEETTNGAVAPADAATGPAFTVEKIYVKDVSFESPNAPTIFNDQVQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQSIDVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDAPSLADSEPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.512 kDa

MSEEITNGAAAPVDAATGPAFTVEKIYVKDVSFESPNAPTIFNDQVQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQSIDVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDAPSLADSEPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.914 kDa

MADQDQNTQQTGSEAPAFNLQRVYLKDLSVEMPNAPHIFLEQEGPAVEVTINVGGQRLAETVFESTVTVTVTTRVNDKVLYLVEGTQAGIFELANIPPEQMDPILGIVCPTMLYPYLRANVADAITRTSLPALHLTEVNFQALYEQRLAEMAQQQEQSADSGIILPPSATRQ

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.684 kDa

MSDEITNGAAKPTEAISGPTFTIEKIYIKDVSFEAPNSPAVFNEAGQPELQLNLNQRVQRLNENAFELVLHVTLTCTAAGKTAYVVEVQQAGVFGLFGLDQHAIGVLLGTQCPNILFPYVRSLVSDLIQIGGFPPFYLQPINFDALYAETLRQRAQNEKEGSQISSQPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.693 kDa

MSDEITNGAAKPTEAISGPTFTIEKIYIKDVSFEAPNSPAVFNEAGQPELQLNLNQRVQRLNENAFELVLHVTLTCTAAGKTAYVVEVQQAGVFGLFGLDQHAIGVLLGTQCPNILFPYVRSLVSDLIQIGGFPPFYLQPINFDALYAETLRQRAQNEKEGSQISSHPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.684 kDa

MSDEITNGAAKPTEAISGPTFTIEKIYIKDVSFEAPNSPAVFNEAGQPELQLNLNQRVQRLNENAFELVLHVTLTCTAAGKTAYVVEVQQAGVFGLFGLDQHAIGVLLGTQCPNILFPYVRSLVSDLIQIGGFPPFYLQPINFDALYAETLRQRAQNEKEGSQISSQPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.684 kDa

MSDEITNGAAKPTEAISGPTFTIEKIYIKDVSFEAPNSPAVFNEAGQPELQLNLNQRVQRLNENAFELVLHVTLTCTAAGKTAYVVEVQQAGVFGLFGLDQHAIGVLLGTQCPNILFPYVRSLVSDLIQIGGFPPFYLQPINFDALYAETLRQRAQNEKEGSQISSQPAGNA

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.178 kDa

MSEENQVAATEAEEQTPFELQIQRIYIKDVSFEAPNLPTIFHQEWKPQLGFELDTETVKLADDLYEVILHINVSTTLEDSGDTAFICEVKQAGVFTIKGLEGIQLAHCLASQCPSVLYPYARELIASLVNRGTFPALNLSPVNFDALFVDYLQRQEQEAAEAEEETPAPASN

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.282 kDa

MTDAPNTPADNAAAQAPQLRVLAQYVKDLSFENPGAPETLRPGQQAPAIDLAIDVQARTAGEDTFEVVLTVNAKASRDESVVFIAELSYAGLFQLANVGETDREPFLLIECPRLIFPFARRVLADATRDGNFPPLMLDPVDFAGLYRAQLAKRAAAAPGSESNGNGDPAAAN

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.886 kDa

MSDQQQANQQDDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPSVEVQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLLGIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGQGGDSGIVMPDGSQARH

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.859 kDa

MSDQQNTQQDDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPSVEVQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLLGIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGAEGGNSGIVMPDGSQARH

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.857 kDa

MSDQQNTQQEDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPSVEVQVNVAASQLQEGIFEVVVTGTVTTKVQEKVAFLVEAHQAGIFDIRNVPVEQLDPLLGIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQAAGGANSGIVMPDGSQARH

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.873 kDa

MSDQQNTQQDDQPFFNIQRVYLKDMSLEQPNSPAIFLESEAPSVEVQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLLGIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGAEGGNSGIVMPDGSQARH

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.182 kDa

MADETTNGAAAPADQQQQPVMPTLKIMAQFIRDMSFENIAAQKGVQGEGQPDIQVQVNLDAKKRTVEKQFEVAIKLNINAKTKESGDMIFGLELDYAGIFFIDNVPDEQMHPFLLIECPRMIFPFVRRIVSDVTRDGGFPPLNLDQIDFVALYRQEIARRAAAQQAAPSAEV

secB

Protein-export protein SecB

172 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.808 kDa

MSDQQQQQPGQDGQPFFNIQRVYLKDLSLEQPNSPHIFLEQEQPSVEVQVDVAASQLAEGVFEVTVIGTVTTKVQEKVAFLVEAKQAGIFDIRNVPAEQMDPLLGIACPTIVYPYLRSNIADTIGRAGFQPIHLAEINFQALYEQRLAAAMEQQGQAGGTGLVMPDGSKATH

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.124 kDa

MSDEILNGAAAPADAAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAESVRQRHNESASLADSEPAGNA

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.124 kDa

MSDEILNGAAAPADAAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAESVRQRHNESASLADSEPAGNA

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.124 kDa

MSDEILNGAAAPADAAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAESVRQRHNESASLADSEPAGNA

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.505 kDa

MSDTTQPPADDAQNVPPAMPLTINVQYIKDLSFEVPAGAEIFATLRANPQIAVNIDVQANRLQAEHPVFEVVLAIKTEALEAPEKEGAAPGRPVFIAELAYGAVVTLTNAPDELVEPILLVEVPRLIFPYVRNIISEVTRDGGFPPVVLQPIDFVALWQAKRSFPQTAGNA

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.822 kDa

MQDEAVTENTASTGPQAGPPLVVNVQYVKDLSFEVPGAPQIFAALRTQPQVDLNLDVQVRRLEEQAHIYEVVLAIRAEAVERVEGEEKANTVFIAELSYGGVFTLNGIPDESIEPVLLVECPRLLFPFARTILATVTREGGFPPVQLQPIDFVALWQARRAQQQQETVGNA

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.458 kDa

MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQLAHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKAEEKEKKEVH

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.488 kDa

MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQLAHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKTEEKEKKEVH

secB

Protein-export protein SecB

171 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.003 kDa

MSDASANGDATEGAAPAAAQLPKMQILGQFIRDLSFENAAVQYGTATQGQPDIQVQVALDARKRTVDNQYDVIMKLKIESKTKDEDAPKSIFLIELEYGGVFLIENIAEQQLHPFLMIECPRMLFPFVRRIISDMTRDGGYPPLNLDQIDFVALYRQQIAARQAQQPVGTA

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.216 kDa

MSEENQVNAADTQATQQPVLQIQRIYVKDVSFEAPNLPHIFQQDWEPKLSFDLSTEAKQVGDDLYEVCLNISVETTMESSGDVAFICEVKQAGVFTISGLEEMQMAHCLTSQCPNMLFPYARELVSSLVNRGTFPALNLSPVNFDALFMDYLQRQEQAEQTTEEENKDVH

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.072 kDa

MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRQNEGTSLADSEPAGNA

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.072 kDa

MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRQNEGTSLADSEPAGNA

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.059 kDa

MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLEPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRSQGETSLADSEPAGNA

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.059 kDa

MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLEPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRSQGETSLADSEPAGNA

secB

Protein-export protein SecB

170 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.059 kDa

MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLEPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRSQGETSLADSEPAGNA

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.533 kDa

MADENQTNNGEAAGAQAQQGAQFNIQRIYTKDISFESPNAPAIFTKEWKPEIKLDIDTSTNKLEENVFEVVLSVTVTATLGEETAFLCEVQQAGIFAIGEMPDQNKAHTLGSFCPNMLFPYARETISNLVNRGTFPPLNLAPVNFDAIFAAYVQKRAQQAQGEAPKMDA

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.67 kDa

MAEENQTTPADAAQAAQGPQFAIQRIYTKDISFETPNSPAIFQKEWKPEVQLDLDTRSALIEENVYEIVLAVTVTAMLGEETAFLCEVQQAGIFAIGEMPEQNKAHMLGSFCPNTLFPYARETISNLVNRGTFPPLNLAPVNFDAIFAAYMQKRAAQQAQEQAPTQLDA

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.132 kDa

MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.131 kDa

MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDNLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.132 kDa

MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH

secB

Protein-export protein SecB

169 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.118 kDa

MAEENQTPATATEEQQAVLQIQRIYVKDISFEAPNLPHVFQQEWKPKLNFDLSTEAKQLGEDLYEVVLNISVETTLEDSGDLAFLCEVKQAGVFTISGLEDMQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFMEFLQRQEQESQNAESSTEVQH

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.217 kDa

MTDSQQPGAATEQPKTEFALQKFYLKDVSLECPRSPQVFTGEWKPETNVQLNSQARPLDDQGLFEVELTLTVTTKSGGEVAYLVEVKQAGVFLARGFPKEQMGHLLAAYCPTTLFPFAREAVTDLVSKAGFPQMLLAPVNFDALYAQQLAQNHAGKAGEESAPAGASH

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.196 kDa

MSDQGTNNGESGNGGAQNGEAPQLRVLTQYVKDLSFENPNAPQSLGPADEQPSINVRVDVGVKRMSATDFEVALKIGAEATVKDKAMFLVELDYAGLFRVVNVPEQDLEAVLVIECPRQIFPFARRILADTTRDGGFPPLMIDPIDFVGLYNQRHQQAPDAAAAAKPN

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.358 kDa

MTTDTASNGNGSAQQQSPSLNILAQYVKDLSFENPGAPRSLQARDRSPSININVNVNANPLAENDFDVVLSLSAQAKDGDKMLFNVELAYGGVFRVAGFPQEHMLPLLFIECPRLLFPFARQIVADATRNGGFPPLMIDPIDFAQMFAQRMAEEKVRAQVANTNDTAN

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.429 kDa

MTDETAANGENEAGRQSQSSSLPLVVNAQYVKDFSFENPNAPQSLMADQGQPKIDLQVDVQARGLNDTVSEVVLSMRAEATRNDRTAFIVELSYAGIFTLPAQIQPEQARAILLIEAPRLLFPFARQIVAEATQNGGYPPLMLQPLDFVDLYRRQVLNRGSNGEVGHA

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.003 kDa

MSEQKQDVAATEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

19.017 kDa

MAEENQVATEEQQTPFEMQIQRIYIKDVSFEAPNLPNIFHQEWKPQLGFDLDTETREIGEDTYEVVLHINVQTTLEDSNDVAFICEVKQAGVFTIKGIEGIQLAHCLAAKCPEVLYPYARELISSLVNRGTFPALNLSPVNFDALFMDYLARQQAEENGESTTNTTLN

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.297 kDa

MTTDSASNGNGSAQQPSPSLNILAQYVKDLSFENPGAPRSLQARDRSPAININVNVNANPLAENDFDVVLSLSAQAKDGDKMLFNVELAYGGVFRVAGFPQEHMLPLLFIECPRLLFPFARQIVADATRNGGFPPLMIDPIDFAQMFAQRMAEEKVRAQVANTNDTAN

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.887 kDa

MSEENTTNNEAAAAEGKAPAGFGIKRVFTKDLSFEVPAGLGAFSLQGQPNVGQDLNTQINRVDDTHYEVVLKVTVTVKMGEDKVAFLAEVHQAGIFQVVGIEGPQLQQVLSTACPQILFPYVRETIDSLAVRGGFAPVLLPQINFDALFVQAVAQAKAQADSQAEADA

secB

Protein-export protein SecB

168 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.529 kDa

MADQPSGNNDAKQAETNGNTVPASLNVLTQYIKDLSFESPGAPQSLRARDKAPSININVNVNANPLGGTDYDVLLTLTAKAEADNVVLFNVELIYGGVFRIQGFPQEHMLPLLFIECPRLLFPFARQIIADATRNGGFPPLMIDPIDFARMFQQRLAEEEARRKVQVS

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.836 kDa

MADENQTPEQNDQQADANQNRFGIKRIYMKDMSFETPMGVQAFQVQWQPKVNQDLNTQVNKLDENHYEVVLKLTITVKMNDDKTAFLAEVHQAGLFEVAGLEAPQLQRLLSSACPEILFPYAREALDSLATRGGFPPLQLPPINFDALFSQAMNQAQQQAEQGQQPN

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.796 kDa

MPQQKMRIHGQYVKDLSFENPNSPFLSSSKAPDINVMVNINSAKLEGTKNKEEVNEEKSFHEITLHIEVKATVKDEGIKDGVAFICETKYCGIFSIENLKELSEEEVRQALFIGGPTFLFPFAREIIARVTSSGGFPPLMLDPIDFETMYEQQGQQQKSNGSNSNFN

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.847 kDa

MSQHKMKIHGQYVKDFSFENPNSPFLPSSKAPDINVMVNINSAKLEGTENKKGISEEKPFHEITLHIEAKATVKDEDVKDDIAFICEVKYCGIFSIENFTELSEEEVRQALFIGGPTFLFPFAREIIARTTSSGGFPPLMLDPIDFETMYQQQSQQQKSSASNSNFN

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.817 kDa

MSQQKMRIHNQYVKDLSLENPNSPFLSLKEVPNIDVMVNVNSVKLEGSEGTEGESEEKSFHEITLHIEAKAMIKDENIKDGVAFICETKYCGIFSVENFAELSTEEVNRALFIGGPTFLFPFAREVIARVTSSGGFPPLMLDPIDFEAMYEQQSRQQKSNASNENFN

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.935 kDa

MASNDDAPVGAANGNGNTGAQPSLNVLAQYVKDLSFESPGAPNSLRGRDKAPGIAINVNVNANPLSDKQFDVNLTLNAKASFDQEVLFNVELVYGGVFAISGFPQEHMLPILFIECPRLLFPFARQIIAEATRNGGFPPLMLDPIDFAQMFQQKIAEDQAASKVKVS

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.796 kDa

MPQQKMRIHGQYVKDLSFENPNSPFLSSSKAPDINVMVNINSAKLEGTKNKEEVNEEKSFHEITLHIEVKATVKDEGIKDGVAFICETKYCGIFSIENLKELSEEEVRQALFIGGPTFLFPFAREIIARVTSSGGFPPLMLDPIDFETMYEQQGQQQKSNGSNSNFN

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.738 kDa

MAEEQQANGAAAENQQQQVQFAIQRIYAKDISFETPSSPAIFRKEWKPDLKLDLNVKHEKIEDGVYEVVLTLTATNKVEDDVAFLCEVHQAGIFTIGEEVQDGQLAHMLGSFCPNILFPYARECVSNLVNRATFPQLNLAPVNFDAIFQRHMQQQAEQAQGQQTADA

secB

Protein-export protein SecB

167 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.241 kDa

MSDENNQQDAQQAAGGPQFAIQRIYLKDLSFETPMGVEAFTKAFKPNIQQDLNIQANQVEEGLFEVVLLLTVTARTDNRAVFLVEIKQAGLFAIGGLEGGAVTQLINTACPQILFPYAREAIDSILNRGSFPPLMLPPINFDAVFVQAISQAQQQAETEKAQGETIN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.001 kDa

MSEETGAADTLTNGEDHLPQVALIAQYVKDLSFENPSAPGIYQAPEQPKIDVQFNIGSQQAGEDVYEVALKIEIKATQGDLTAYAVELVYAGLFGIRNVPEEHLPPFLLAEAPRLLFPFARRVAADAIRDGNFPSLVLEPIDFGALYMQQAEQQTALAESQPAGEA

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.659 kDa

MTDANGAPAEAAPQIRMQVLAQYVRDMSFENMVAQKGLQGGDVQPDIQVQVSLDARKRSVEHQYEVITKFKVTSKNKSGSAETLFLLELDYGGIFHVENVPEDQLHPFLLIECPRLLFPFVRRIISDVTRDGGFPPLNVDTVDFLALYRMELARRAEAQKAAQPVQ

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.659 kDa

MTDANGAPAEAAPQIRMQVLAQYVRDMSFENMVAQKGLQGGDVQPDIQVQVSLDARKRSVEHQYEVITKFKVTSKNKSGSAETLFLLELDYGGIFHVENVPEDQLHPFLLIECPRLLFPFVRRIISDVTRDGGFPPLNVDTVDFLALYRMELARRAEAQKAAQPVQ

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.707 kDa

MTDANGAPAEAAPQIRMQVLAQYVRDMSFENMVAQKGLQGGDVQPDIQVQVSLDARKRSVEHQYEVITKFKVTSKNKSGAAETLFLMELDYGGIFHVENVPEEQMHPFLLIECPRLLFPFVRRIISDVTRDGGFPPLNIDTVDFLALYRMELARRAEAQKAAQPVQ

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.659 kDa

MTDANGAPAEAAPQIRMQVLAQYVRDMSFENMVAQKGLQGGDVQPDIQVQVSLDARKRSVEHQYEVITKFKVTSKNKSGSAETLFLLELDYGGIFHVENVPEDQLHPFLLIECPRLLFPFVRRIISDVTRDGGFPPLNVDTVDFLALYRMELARRAEAQKAAQPVQ

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.961 kDa

MSETQIAPLTLNIQYTKDLSFEVPGAPAIYTLLRQAPTVNINLDVQVQRLQDDAHVYEVTLTTRAEATHPAPAESGNGAEGGKDLTVFIADLSYAGVFTLTGIPDNQIEPVLLVECPRLLFPFARNILADVTRDGGFPPVMLGPVDFVGLWQARRAQDDGETIANA

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.647 kDa

MAEENQVAAPEEAQTPFELQIQRIYIKDVSFEAPNLPTIFHQEWKPQLGFELDTETKQLDEDLYEVVLHINVSTTLEDSGDTAFICEVKQAGVFTIKGIEGIQLAHCLASQCPNVLYPYARELISSLVNRGTFPALNLSPVNFDALFMDYLQRQEAEQNAEAPAVN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.738 kDa

MTEENQVTAQEEAQTPFELQIQRIYIKDVSFEAPNLPTIFHQEWKPQLGFELDTETKQLDEDLYEVVLHINVSTTLEDSGDTAFICEVKQAGVFTIKGIEGIQLAHCLASQCPNVLYPYARELISSLVNRGTFPALNLSPVNFDALFMDYLQRQEAEQNAEAPAVN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.738 kDa

MTEENQVTAQEEAQTPFELQIQRIYIKDVSFEAPNLPTIFHQEWKPQLGFELDTETKQLDEDLYEVVLHINVSTTLEDSGDTAFICEVKQAGVFTIKGIEGIQLAHCLASQCPNVLYPYARELISSLVNRGTFPALNLSPVNFDALFMDYLQRQEAEQNAEAPAVN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.492 kDa

MTDENQAAPAEQAQEPVLQIQRIYVKDVSFEAPNLPDIFQQEWKPNLNFDLGTEAKQLGENLFEVTLNVSVETTLEDSGDAAFICEVKQAGVFTIGGLTDIQLTHALTSQCPNMLFPYARELVASLVNRGTFPPLNLAPVNFDALFLEHMRRVEEESAPEEQPTLN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.728 kDa

MTDTSAAGNPTPGQQPANPPSLRVLGQYVKDLSFENPGHPPVQTQPNIDLGIDVGASPHADGNGLFEVSLKLSAKASAGDTVLFISELDYAGLFQLQNVPEGQVEAMLLIECPRLLFPFARRIIAEITREGGFPPLLIDPVDFVALYQSQYRRAAERAQNGNGGAS

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.095 kDa

MTTDTASNGNGAQQAPSLNILAQYVKDLSFENPGAPRSLQARDQAPSININVNVNANPLAENDFDVVLSLNAQAQDGDKVLFNVELAYGGVFRVSGFPQEHMLPLLFIECPRLLFPFARQIVADATRNGGFPPLMIDPIDFAQMFAQRMAEEKVRAQVANSNTTTN

secB

Protein-export protein SecB

166 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.812 kDa

MAEEEEAKTEANGQQQAPQMRVLGQFIRDMSFENIMAQKGAPSDAQPDVQVQVNLDAKKRTADNQYESAIKLNVTSKVKDGDATLFVLELDYVGIFHVDNVPDEQLHPFLLIECPRMIFPFLRRIVSDITRDGGFPPLNLENIDFLSLYRNELARRQSSEAPKMDA

secB

Protein-export protein SecB

165 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.259 kDa

MAENQQAAGNENQNQPQFALQRIYVKDLSFESPNSPLVFQEQWKPQVNLDLNTSHNKISDNQYEVVLSLTVTAKVGEKVAYIVEIQQGGVFMISGIEGPQLGQMLGAYCPTILFPYAREAIDGIVNKGSFPALMLAPVNFDAIYAQALKRKQEEAAGEAKEEQTH

secB

Protein-export protein SecB

165 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.282 kDa

MAEENQVENSEAAQQSPEFAIQRIYTKDVSFETPNSPAVFQLDWKPEIQLDLDTRSTKLADNTYEVVLSVTVTATVEDKTAFLAEVQQAGIFTIGNLPEAQLAHTIGAFCPTTLFPYARETVASLVNRGSFPQFNLTPVNFEGLYASYVQQRATQENVAQSSETH

secB

Protein-export protein SecB

165 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.548 kDa

MAETDAAAAQQPPQIQMRVLGQFIRDMSFENVMAQRGASGDVQPDVNVQVNLDAKKRSTDNQYEIAIKLNITSKAKGMDDVLFVFEIDYCGIFHVEGVPNEQLHPFLLIECPRMLFPFLRRIVSDITRDGGYPPLNLDNIDFMALYRSELARQQAAAQAEQKADA

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.623 kDa

MTNGNGAPPEAAQAPQLNVLAQYTKDLSFENPNAPASLAPQAQQPSINIQINVTANTLADSEFEVTLAIEGKADNAGSLIFSFELLYAGVFRILNVPKENLHPLVMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGLYRQNMERQAAAAASADEAKPS

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.897 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKADRLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAAGAPNGAPNGTTLN

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.897 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKADRLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAAGAPNGAPNGTTLN

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.897 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKADRLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAAGAPNGAPNGTTLN

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.473 kDa

MPDKDEITHDAQSENEESLPLARPEGQFMKSIALDTPNSPEVFSIMKNPPEVDVQCNIDSRAIDERNGVYEVVLDLKTEARIKDKDSPDETRVAFVCKLKYCGVFTIKNLTQEQLRQTLLVEAPTLLFPFARRIIATATTDAGFPPLMLAPINFAQKYAESQRD

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.25 kDa

MAEDSTNQQTSEQGQQAQFAIQKIYVKDLSFETPNSPHIFNQEQEWKPEFNLQLSNKNQRIAENVHEVVLSLTVTAKLGDQTAFLVEVHQAGIFMLNGYGEESLGSLLGSYCPNILFPFAREVVADLVTKGGFPPLLLAPVNFDALYAQQQQQRQSAGAAEVRH

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.717 kDa

MVATSKPKSEPKIAVKAQYVKDLSFENPDPINSLFKITEKPKIDTKLDINITKLSEDNHFEVELSTNVSATCNDKKIFHIEVVYAGIFQLTNISEEDKKFILSVRCPEIIFPYVRQIISESTQKGGFLPLMIDYIDFAEIISNTQTTNNQQELIKPEFDVSNKQ

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.861 kDa

MADENLQPVFQIQRVYLKDLSLEQPNSPAIFLEQDAPVIEVAVDVGAEQLAEGLFESTVTITVTAKINDKVAFLVEAKQAGIFEARNIPDEQLDPLIGIGCPSTIYPYLRANIADAITRAGFPPVHLSEINFEVFYQQRLEALAQQHASNGSGIVMPDGSAAQH

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.096 kDa

MAEVANNEQQEQAPQFNIQRIYTKDLSFETPNSPAVFQKEWNPEVKLDLDTRSNKLSDDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFSIQGLTEQQLAHSLGAYCPNVLFPYARELVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAEAPAVEEANA

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.991 kDa

MADENLQPLFQIQRVYLKDLSLEQPNSPAIFLEQEQPTIEVAVDVGAQPLAEGIFESTVTITVTAKIADKIAFLVEGKQAGIFEIRNIPDEQLDPLLGIGCPNVIYPYLRANIADAITRAGFPPVHLSEINFEVFYQQRLEALAQQQADNSSGIVMADGSAARH

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.384 kDa

MSGNNFNASNADTDHLPQVSILAQYIKDLSFENPNAPAVYQWQTQPHIEVQFNIGTQPMAQDVYEVALKVDVSAKADEGVVFHVELVYNGLFAIKNVPADQIQPFLYIEAPRILFPFVRRILADSVRDGNFPPLMLEPIDFAALYMQQTEQQDMLSNTEPAGQA

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.231 kDa

MAENGAAEGTAQQPQVQMNILGQFIRDLSFENVMAQKGVGGEVQPDVNVQVALDAKKRSTENQYEVITKLNIESKNKAGGEVLFVLELEYVGIFNIAGVPEDQLHPFLLIECPRMLFPFLRRIVSDISRDGGFPPLNLDNIDFVAIYRNELARRQAEAPAEVTN

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.474 kDa

MTDTTAAPPAAPEDGAPGETGIRIIAQFVRDFSFESPHAPDSLRAGGAPPAIDMGVEMNARGRPDGLFEVDLKLSARATRDEQPVFHVEVLYGGLFHIAGVPEGDLEPVLLIECPRFLFPYARRLISDVTTEGGFPPFLIDPIDFAGVYAARKAQAEGVVVGNA

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.1 kDa

MAEDNNQAAQGGNDAQNQLQFSMQRIYVKDISFESPNAPSVFQNAFKPKVGLDLNTTHKQVGENLYEVVVKVTAQVTNNEDGATAFLAEVEQAGLFRIAGLSDDQLDHTLGAFCPNMLFPYARECIDNLVNRGSFPPLMLSPVNFEGMYAQKKKRESEAAENAH

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.179 kDa

MTDQPNNGAVANEENGPQFSLQRIYVRDLSFEAPKSPAIFRQEWTPTVSLDLNTRQKPLEGDFYEVVLTLSVTVNNGEEVAFIVEVQQAGIFLIKGLDDAAMSHTLGAFCPNILFPYAREAIDNLVVRGSFPALMLAPVNFDALYAQELQRMQEAGETPMPTVQ

secB

Protein-export protein SecB

164 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.903 kDa

MTEQANNGGAASQNEQGAQFSLQRIYVRDLSFEAPKSPEIFRQEWNPSVALDLNTKQKQLESDFYEVVLTLSVTVKTGEEVAFIAEVQQAGIFLIKGLEAAAMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQEMARMQSAGEAPATAH

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.787 kDa

MTEQASNGAAQDGQNAQFSLQRIYVRDLSFEAPKAPEIFRQDWKPSVQLDLNTRQKALDGGDFYEVVLSLSVTVKTGEEVAFIAEVQQAGIFLIKGLDAEAMGHTLGAFCPSLLFPYAREALDNLVVRGSFPALMLAPVNFDVLYAQELARMQAEGQASGTVQ

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.582 kDa

MSETDAGAPGAPEAAEGQAPGIRILAQFIRDLSFENPRAPDALRAAQTQPQIDLGVEMNARGREDGLFEVDLKLSARATRDDGALFVVELLYGGVFQIAGVPAEDLEPVLLIECPRYLFPFARRIIADVTAEGGFPPFMLDPIDFAGVYAARKAQEQEQVGHA

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.146 kDa

MTEQATNGAADEQQPQFSLQRIYLRDLSFESPKSPEIFRQEWNPSISLDLNTRQKQLDGDFYEVVLTVSVTVKNGEDTTAFIAEVQQAGIFLIKNLDPSSMSHTLGAFCPNILFPYAREALDNLVVRGSFPALMLSPVNFDALYAQEIARMQASGEIPTPSVQ

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.146 kDa

MTEQATNGAADEQQPQFSLQRIYLRDLSFESPKSPEIFRQEWNPSISLDLNTRQKQLDGDFYEVVLTVSVTVKNGEDTTAFIAEVQQAGIFLIKNLDPSSMSHTLGAFCPNILFPYAREALDNLVVRGSFPALMLSPVNFDALYAQEIARMQASGEIPTPSVQ

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.146 kDa

MTEQATNGAADEQQPQFSLQRIYLRDLSFESPKSPEIFRQEWNPSISLDLNTRQKQLDGDFYEVVLTVSVTVKNGEDTTAFIAEVQQAGIFLIKNLDPSSMSHTLGAFCPNILFPYAREALDNLVVRGSFPALMLSPVNFDALYAQEIARMQASGEIPTPSVQ

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.146 kDa

MTEQATNGAADEQQPQFSLQRIYLRDLSFESPKSPEIFRQEWNPSISLDLNTRQKQLDGDFYEVVLTVSVTVKNGEDTTAFIAEVQQAGIFLIKNLDPSSMSHTLGAFCPNILFPYAREALDNLVVRGSFPALMLSPVNFDALYAQEIARMQASGEIPTPSVQ

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.879 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAESAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.878 kDa

MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.84 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKAERLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAGAPNGAPNGTTLN

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.826 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKADRLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAGAPNGAPNGTTLN

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.832 kDa

MSDKAAGEVKNGNGATAEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNANPLSETDFDVVLTLEAKAVDGKDVLFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPFARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAKSAVKS

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.457 kDa

MAEQDSNPVFQIQRVYLKDVSLEQPNSPQILLEQSQPQVDISLAVNAETVADGIYEVSVTATVTTKVADKTLFLCEAKQAGIFEIRNLPDGQTQPVLGIACPGIVYPYLRATVADIITRAGFPPVHLAEVNFQAMYEAQQQAAAQQQGAVSNGNGGSPIITNA

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.843 kDa

MAEVANNEQQDPQFNIQRVYTKDISFETPNSPAVFQKEWTPEVKLDLDTRSAKLADNVFEVVLSLTVTAKNGEETAFLCEVQQAGIFAINGLTEQQLAHSLGAYCPNILFPYAREAVGSLVARGTFPQLNLAPVNFDALFAQYVNQRQAGAEEAAAKTEEASA

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.458 kDa

MTDTIAPEATPEGAEAGQAGIRILAQFVRDFSFENPLAPDALRAGAAQPAIDMGVEMNARGRADGLFEVDLKLSARAEREGQAVFHVEVVYGGLFHIAGIAEEDLEPVLLIECPRFLFPYARRLISDVTAEGGFPPFLIDPIDFAGVYAARKAQAEGQQVGNA

secB

Protein-export protein SecB

163 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.458 kDa

MTDTIAPEATPEGAEAGQAGIRILAQFVRDFSFENPLAPDALRAGAAQPAIDMGVEMNARGRADGLFEVDLKLSARAEREGQAVFHVEVVYGGLFHIAGIAEEDLEPVLLIECPRFLFPYARRLISDVTAEGGFPPFLIDPIDFAGVYAARKAQAEGQQVGNA

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.632 kDa

MTNGNGANPEAAPPPQLNVLAQYIKDLSFENPNAPQSLAPQGQPPQINIQINVGANALADTEFEVTLTIEGKAESGTQVMFSFELVYGGVFRLVNVPQEHLSPMLLIECPRLLFPFAREIVANSVRDGGFPPLMLDPVDFVSLYRQNMERQAAAQGAQIRPS

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.953 kDa

MTDQPNNGAVANEENGPQFSLQRIYVRDLSFEAPKSPAIFRQEWTPTVSLDLNTRQKQLEGDFYEVVLTLSVTVNNGDEVAFIVEVQQAGIFLIKGLDDGAMSHTLGAFCPNILFPYAREAIDNLVVRGSFPALMLAPVNFDALYAQELQRMQEAGETPTVQ

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.607 kDa

MTNGNGATPEAAPPPQLNVLAQYIKDLSFENPNAPQSLAPQGQPPQINIQINVGANALAETEYEVTLTIEGKAESGSQVMFSFELVYGGVFRLVNVPQEHLSPMLLIECPRLLFPFAREIVANSVRDGGFPPLMLDPVDFVSLYRQNMERQAAAQGVQGRPS

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.463 kDa

MLEEENSQMICQIYRIYTKDISFEAPGAPQIFQKEGSPDIKLDLDTSSNLLAENTHEVVLRITLTATIEGQTSFLCEVQQAGIFFIKNIENMQLKHCLGAYCPNILFPYARECISNLVSKGSFPHLHLEPINFDSLFMNYVQQEAEKQNESDPIIIKNSEQD

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.357 kDa

MTEQLNTNQQNDEAQFMIQRIYIKDLSYETPNTPAVFQQQWEPELKLDLNTTTTQLDKNVYEVVLTVTTTVMNQKTTAFLVEVKQAGIFTIQGAAASQLDHLLHSFCPSILFPYAREAITSQVIRGSFPQLVLAPINFDALYMQQLEEKQKATGAKDETVSH

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.357 kDa

MTEQLNTNQQNDEAQFMIQRIYIKDLSYETPNTPAVFQQQWEPELKLDLNTTTTQLDKNVYEVVLTVTTTVMNQKTTAFLVEVKQAGIFTIQGAAASQLDHLLHSFCPSILFPYAREAITSQVIRGSFPQLVLAPINFDALYMQQLEEKQKATGAKDETVSH

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.327 kDa

MTEQLNTNQQNDEAQFMIQRIYIKDLSYETPNTPAVFQQQWEPELKLDLNTTTTQLDKNVYEVVLTVTATVMNQKTTAFLVEVKQAGIFTIQGAAASQLDHLLHSFCPSILFPYAREAITSQVIRGSFPQLVLAPINFDALYMQQLEEKQKATGAKDETVSH

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.357 kDa

MTEQLNTNQQNDEAQFMIQRIYIKDLSYETPNTPAVFQQQWEPELKLDLNTTTTQLDKNVYEVVLTVTTTVMNQKTTAFLVEVKQAGIFTIQGAAASQLDHLLHSFCPSILFPYAREAITSQVIRGSFPQLVLAPINFDALYMQQLEEKQKATGAKDETVSH

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.642 kDa

MAEAVNNEQQGPQFNIQRVYTKDISFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFAISGLTDQQLAHSLGAYCPNVLFPYAREAVGSLVARGTFPQLNLAPVNFDALFAQYVQQRQAQAEAAGEAAEANA

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.873 kDa

MAEVANNEQQEPQFNIQRVYTKDISFETPNSPAVFQKEWNPEVKLDLDTRSAKLADNVFEVVLSLTVTAKNGEETAFLCEVQQAGIFAINGLTEQQLAHSLGAYCPNILFPYARETVGSLVGRGTFPQLNLAPVNFDALFAQYVNQRQEGAEEAAQTEEASA

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.94 kDa

MNEETQNAAAQQETGAQFTIQRIYTKDVSFETPNSPAIFQKEWTPEVKLDLDTRSNKLDEGVFEVVLALTVTASIGEETAFLCEIQQAGIFTIADVEETQLAHMLGAFCPNVLFPYAREAVSNLVNRGTFPQLNLAPVNFDALFAQYMQQRTAQAEQASVDA

secB

Protein-export protein SecB

162 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.011 kDa

MTDQPNNDAVANEENGPQFSLQRIYVRDLSFEAPKSPAIFRQEWTPTVSLDLNTRQKQLEGDFYEVVLTLSVTVNNGDEVAFIVEVQQAGIFLIKGLDDGAMSHTLGAFCPNILFPYAREAIDNLVVRGSFPALMLAPVNFDALYAQELQRMQEAGETPTVQ

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.456 kDa

MTNGNGTPPEAAPAPQLNVLAQYTKDLSFENPNAPSSLQQQGQPPQINIQINVGANNLSEQEFEVTLSVEGKAETAGKVMFSFELAYAGVFRIVNVPKENLHPLVMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGLYRQNMERQMAAGGQAGQA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.472 kDa

MTNGNGTPPEAAPPPQLNVLAQYTKDLSFENPNAPASLAPQPQQPAINIQINVGAKALAENEYEVTLSIEGKAEGASSLIFSFELQYAGVFRIVNVPQENLHPLVMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGLYRQNMDRQAAEAQQASPN

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.593 kDa

MANGNGTGAEVDAAPAINAMVQYTKDFSFENPNAPRSLGPQDKPPNIQIQVNVNAKQVAENDFEVNILLEGSAKTDADTLFKFELDYAGLFRLINIPQSDAHPVIMIECPRLLFPFARQIIADAVRSGGFPPLYIDPIDFAALYRQRMSQVAANEQAPTVA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.138 kDa

MTESQQQPVFVIEKIYVKDLSLEIPHAPRIFLEREAPEINFQLATSHNAVDGEIHEVVVTATVTARLKEKDQVMFLVEAHQTGIFRIGNVPGDEVEPVLSVLCPNILFPYLRETISDTVTRAGFPPVILNPVNFEAIYHQKKQQETAGEQPDQPADTITRH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.509 kDa

MTDTTAASAEAAAPPQLGILTQYIKDLSFENPNAPASLSQQGKQPDITIQINVGATNLGGTDFEVMLAIEGKAMAEDKVLFALELAYAGVFRIENVPQDSLHPFVMIECPRLLFPFAREIVASATRNGGFPPLMLDPVDFVGLYRQNMARQAEQQQQSKPN

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.483 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGDTAFLCEVQQAGIFSITGLTEPQLAHSLGAYCPNILFPYARETVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.517 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGDTAFLCEVQQAGIFSITGLTEPQLAHSLGAYCPNFLFPYARETVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.483 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGDTAFLCEVQQAGIFSITGLTEPQLAHSLGAYCPNILFPYARETVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.483 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGDTAFLCEVQQAGIFSITGLTEPQLAHSLGAYCPNILFPYARETVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.627 kDa

MAEVANNEQQGPQFNIQRVYTKDISFETPNSPAVFQKEWNPEVKLDLDTRSNKLSDDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFAIAGLTEQQLAHSLGAYCPNVLFPYAREAIGSLVSRGTFPQLNLAPVNFDALFAQYVQQRQAAAADAPAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.641 kDa

MAEVANNEQQGPQFNIQRVYTKDISFETPNSPAVFQKEWNPEVKLDLDTRSNKLSDDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFAIAGLTEQQLAHSLGAYCPNVLFPYAREAIGSLVSRGTFPQLNLAPVNFDALFAQYVQQRQAAAAEAPAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.452 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGETAFLCEVQQAGIFSISGLTEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.659 kDa

MAEVANNEEQAPQFNIQRVYTKDISFETPNSPAVFQKEWTPEVKLDLDTRSNKLSDDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFAITGLTEQQLAHSLGAYCPNVLFPYAREAVGSLVSRGTFPQLNLAPVNFDALFAQYVQQRQAAAAEAPAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.421 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNAGETAFLCEVQQAGIFSIAGLTEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.421 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNAGETAFLCEVQQAGIFSIAGLTEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.406 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNAGETAFLCEVQQAGIFSIAGLSEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.452 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGETAFLCEVQQAGIFSISGLTEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.377 kDa

MAEQNQRTNTPDNGPEFAIQRLYIKDLSFEAPRSPQVFLEEWQPELNMDLATKVNDLGEDNHEVVLTVTVTVTMKESHIFLAEVQQGGIFTIKNFPKEEMRPMLGSFCPNILYPYAREAITDMVVRGGFPQLYLAPVNFDALFEQHEQSEEGNSGTEDRVH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.367 kDa

MAEQNQRTNTPDNGSEFAIQRLYIKDLSFEAPRSPQVFLEEWQPELNMDLATKVNDLGEDNHEVVLTVTVTVTMKESHIFLAEVQQGGIFTIKNFPKEEMRPMLGSFCPNILYPYAREAITDMVVRGGFPQLYLAPVNFDALFEQHEQSEEGNSGTEDRVH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.377 kDa

MAEQNQRTNTPDNGPEFAIQRLYIKDLSFEAPRSPQVFLEEWQPELNMDLATKVNDLGEDNHEVVLTVTVTVTMKESHIFLAEVQQGGIFTIKNFPKEEMRPMLGSFCPNILYPYAREAITDMVVRGGFPQLYLAPVNFDALFEQHEQSEEGNSGTEDRVH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.377 kDa

MAEQNQRTNTPDNGPEFAIQRLYIKDLSFEAPRSPQVFLEEWQPELNMDLATKVNDLGEDNHEVVLTVTVTVTMKESHIFLAEVQQGGIFTIKNFPKEEMRPMLGSFCPNILYPYAREAITDMVVRGGFPQLYLAPVNFDALFEQHEQSEEGNSGTEDRVH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.377 kDa

MAEQNQRTNTPDNGPEFAIQRLYIKDLSFEAPRSPQVFLEEWQPELNMDLATKVNDLGEDNHEVVLTVTVTVTMKESHIFLAEVQQGGIFTIKNFPKEEMRPMLGSFCPNILYPYAREAITDMVVRGGFPQLYLAPVNFDALFEQHEQSEEGNSGTEDRVH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.605 kDa

MTEQANSGAAAAESQNPQFSLQRIYVKDLSFEAPKSPEIFRQEWTPSVGLDLNTRQKTLEGDFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKGLDAASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLSPVNFDALYAQELQRMQQAGEAAAH

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.754 kDa

MTDQQTNGAAAEDNSPQFSLQRIYVRDLSFEAPKSPQIFRQTWEPSVALDLNTKQKSLEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIANLDAPSMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEAPTVQ

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.892 kDa

MTDQQNTAASEEETAPQFSLQRIYVRDLSFEAPKSPAIFRQQWDPAVALDLNTRQKALEGDFYEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDAASMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLAPVNFDALYAQELQRMQESGETPTVQ

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.796 kDa

MTDQQTNGAAAEDNSPQFSLQRIYVRDLSFEAPKSPQIFRQTWEPSVALDLNTKQKALEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIANLDAPSMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEVPTVQ

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.754 kDa

MTDQQTNGAAAEDNSPQFSLQRIYVRDLSFEAPKSPQIFRQTWEPSVALDLNTKQKSLEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIANLDAPSMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEAPTVQ

secB

Protein-export protein SecB

161 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.833 kDa

MTDQQTNGAAAEDNSPQFSMQRIYVRDLSFEAPKSPQIFRQTWEPSVALDLNTKQKALEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDASSMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEAPTVQ

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.272 kDa

MATQNGSPTDNTAPALNVLVQYIKDFSFENPNAPRSLGAPQGQPDVNIQINVNARPLAPGEFEVELKIEGGAAVQGNTLFAFDLTYGGIFRLMNVPEQSLQPVVLIECPRLLFPFARQIVADAVRGGGFPPLMIDPVDFAALYQQRMMAEAQNLQTAGQA

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.568 kDa

MADGNGTQETQDQAPAINAMVQYTKDFSFENPNAPRSLGPQEKAPNIAIQVHVNAQQLAESDFEVNIVLEGSAGEGANTLFKFELDYAGMFRLLNISPNDMHPVVMIECPRLLFPFARQIIADAVRSGGFPPLYIDPIDFAALYRKRLDEVAASAPQLKS

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.74 kDa

MTEQQTNGATDANAPQFSLQRIYVRDLSFEAPKSPQIFRQQWEPSVSLDLNTRQKALEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIANLDAASMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEVPTVQ

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.592 kDa

MADDNNSNGATNPTLSILAQYTKDLSFENPGAPRSLQARDKAPTININVNVNANPLSDTDFDVVLSLNAEAKDGDKTVFHTELVYGGVFRVAGFPQEHMLPVLFIECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.534 kDa

MADDNNSNGAANPTLSILAQYTKDLSFENPGAPRSLQARDKAPTININVNVNANPLSDTDFDVVLSLNAEAKDGDKTVFHAELTYGGVFRVAGFPQEHMLPVLFIECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.522 kDa

MADDNNTNGAASPTLSILAQYTKDLSFENPGAPRSLQARDKAPTININVNVNANPLSDTDFDVVLSLNAEAKDGDKTVFHTELAYGGVFRVAGFPQEHMLPVLFIECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVEAVPN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.55 kDa

MSDETATPGADQAPLIINGQYIKDLSFEVPNAPRIFAELDGQPEVPINVDVTATPVGERFFEVSLKFRIEGRIKGKVAFIAELDYCAVATVNLPDEHIHPVLLIEVPRLMFPFARNILADLTRDGGFLPLMIQPLDFAAMYRNRVQAAQSQAAAENAAAN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.036 kDa

MTEPQQQPVFVIEKVYVKDLSLEIPHAPQVFLERESPEINLQLATSDNVIEGEIHEVIVTATVTARLKEKDKVMFLVEAHQAGIFRIRNVPGNEIEPVLGVLCPNILFPYLRETISDTVTRAGFPPVILNPVNFEAIYQQKQQEAAVSQPDQPVDNTTRH

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.219 kDa

MVATSEPKIAVKAQYVKDLSFENPDPINSLFKITEKPKIDTKLDINITKLSEDNHFEVELSTNVSATCNDKKIFHIEVVYAGIFQLTNISEEDKKFILSVRCPEIIFPYVRQIISESTQKGGFLPLMIDYIDFAEIISNTQTTNNPQKSIKPEFDVSNKQ

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.311 kDa

MTAENGAQGAVSPSLNILAQYIKDLSFENPGAPRSLQGRENAPAININVNVNANPISGSDFDVVLTLNAEAKDGDKILFAAELVYGGVFRIAGFPQEHMLPVLFIECPRLLFPFARQIIADVTRNGGFPPLMIDPIDFSQMFAQRVAEEQAKAQVQAVPN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.75 kDa

MAEAAQQEQQNFAIQRIFLKDVSFEAPNSPNMFQKEWNPDVKLDLDTQSRELGEGVYEVILRLTVTVKNEEETAFLCEVQQGGIFTAGQMEEAQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPANFDALFMNYLQNQASETAEAPAEAPAEA

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.558 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKADRLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAAGAPNGTTLN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.599 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKAERLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQQAGAAGAPNGTALN

secB

Protein-export protein SecB

160 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.752 kDa

MTDQQNTAASEDEAAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEDDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIRNLDAASMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLAPVNFDALYAQELQRMQQEGGATVQ

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.418 kDa

MTENAQAAQPVFSIEKLYVKDLSLEVPNAPKIFLDRENPQINVQLRTEASNVDEGVFEVTLTVTVSSKLPEDRTVFLVEVAQAGIFQIRNIPEGDLEAVMMIGCPNILFPYARESVSDAITRAGFQPVVLAPVNFESLYQAQQQQQAAAAAQAGELPIQ

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.031 kDa

MAQGGEINNDNEKPIFAVLTQYLKDLSFENPNAPRSLRPREKSPKIDININVDANPVGDDNYDVVLSLSVKADDDNDILFHVELVYGGVFHIQNIPQEHIMPLVFIECPRLLFPFVRQIISDATQNGGFPPLWIDPIDFVTLFQRRITAEQKDKPTQSS

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.501 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKAERLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.549 kDa

MTNGNGTPPEGAPSPQLNVLAQYTKDLSFENPNAPSSLAPQQKPPSISVQINVNANNVAQDEFEVTLTVEGKAEHNDKLMFRFELAYAGLFRIVNVPQENLPPLVMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGMFRQNMERQAAVQQKPS

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

18.199 kDa

MSDEQQQPVFSIEKVYVKDLSVEIPNAPRIYLERETPEVNIQLHSKSERIDETLYEVVLTTTVTAKIKDKTMFLVEIQQGGVFQIRHVPEAEMELVLGIACPNILFPYLREAVSDTVTRAGFHPVILNPVNFEALYYQRKQQTENSAAPQTPETQQITH

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.453 kDa

MTNGNGTPPETAPSPQLNVLAQYTKDFSFENPNSPASLAPQQQPPSINVQINVGASNVAENDYEVVLKVEGKAEHAGKLMFSFELAYAGVFRIVNVPQENLHPLVMIECPRLLFPFAREIVATAVRDGGFPPLMLDPIDFVSLYRQNMERQAAAQQQPS

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSENAEAPKQPVFALQRIYLKDLSFESPNSPAVFQSEWKPQVNMDLNTENKKVSDNQWEVVLTLTITAKLADKTAFVIEVQQAGVFMIDGLSPQQLAQTLGAFCPNILFPYARETIDMLAVKGSFPALMLQPVNFDAIYAEAVKRQQAQQAAPAEEAKH

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.495 kDa

MAEVANNEQQAPQFNIQRIYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSTKLADDIFEVVLSVTVTAKNGDETAFLCEVQQAGIFHIGGLTEPQLAHSLGAYCPNILFPYARESVASMVSRGTFPQLNLAPVNFDALFAQYVQQRAAAAQPTEEANA

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.722 kDa

MSDTAETQEAQTQEAQTPQLSMQRVFLKDISFESPRSPMIFQEEWKPEVGLELNTKSRQVGENVYEVVLEITVTVKNNGNTGYLVQVQQGGLFVISGLDDQQLHHALGAFCPATLFPYARENIDAVVVKGSFPAIMLAPINFDALYIESLQKQQAETTQ

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.671 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.501 kDa

MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDVKAERLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQAGAAGAPNGTTLN

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.622 kDa

MTDQQNTVADDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQTALEADFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDEASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQSAGENTVQ

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.626 kDa

MTDQQNTEAAEAQGPQFSLQRIYVRDLSFEAPKSPAIFRQEWTPSVALDLNTRQKALEGDFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIQGLDEASMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLAPVNFDALYAQELQRMQQEGSSTVQ

secB

Protein-export protein SecB

159 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.563 kDa

MADDNNNGATNPTLSILAQYTKDLSFENPGAPRSLQARDKAPTININVNVNANPLSDTDFDVVLSLNAEAKDDDKTVFHTELVYGGVFRVAGFPQEHMLPVLFIECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.573 kDa

MQPKIRVRGQYIKDLSFENPNAPKVFLMMSKTPPEINISVNVSSAALPVKPPEGEQASVALYEVALQINIESVVEKLPAFICEIKYCGVFSIEEDEELEQEQVKRALLINAPSILFPFVREVIAKVTSSAGFPPLMLEVIDFSAMYEKQLAENADGEK

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.711 kDa

MAESEINNNDGEPVFAVLTQYLKDLSFENPSAPRSLRPREKAPQIDININVNANPIGDDNYDVVLSLSVKASDDSETLFHVELIYGGVFHIKNIPQEHVMPLVFIECPRLLFPFARQIISDATQNGGFPPLWIDPIDFAALFQKRVAEEQKNSQTLSS

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.807 kDa

MVKSEINNNGGEPVFAVLTQYLKDFSFENPSAPRSLRPREKAPQIDININVNANPIGDDNYDVVLSLSVKANDNNETLFHVELIYGGVFHIKDIPQEHIMPLVFIECPRLLFPFARQIISDATQNGGFPPLWIDPIDFAALFQKRVAEEQKNSQTQPS

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.487 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPKAPQVFQQEWQPEVKLDLDTASSQLADDIYEVVLRVTVTASLGEETAFLCEVQQGGIFTVGGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQTEGEGEGAAQHQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.522 kDa

MSEQSNTEMAFQIQRIYTKDISFEAPNAPQVFQQEWQPEVKLDLDTASSELAQGVYEVVLRVTVTAALGEETAFLCEVQQGGIFSIDGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEQSQGGEQTEQEA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.132 kDa

MTNGNGTPPEAAAPPQLNVLAQYTKDLSFENPNAPASLAPQQSQPAINIQINVGANNLAENEFEVTLSIEGKAESGSTVLFSFELAYAGVFRIVNVPQENLHPLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNLERAQQQGQPS

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.196 kDa

MTNGNGAPPEAVAAPQLNVLAQYTKDLSFENPNAPASLAQQQQQPAINIQINVGANNLAENEYEVTLSVEGKAESGSTVLFSFELAYAGVFRIVNVPQENLHPLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNMERQAQQGQPS

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

158 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.576 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.164 kDa

MTEAANSTPAQPEFQIQRIYVKDVSFEAPNTPVVFQKEWQPEIKLDMDTQTQVLGQDVYEVALTLTVTCKLGEETAFLCEVKQAGIFTAANLDAQNLAHCLGAFCPNILFPYARETVAGLVSRGSFPQLNLAPVNFDALFASHIAQLEAEQAKAGVQ

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.524 kDa

MAEVANNEAQQNFQIQRVFLKDISFEAPNSPDMFQKEWNPDVKLDLDTQSRELGEGVYEVILRLTVTVKNAEETAFLCEVQQGGIFTVSGMEAPQLAHCLGAFSPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQNQAEANTESTEKA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.693 kDa

MSEQQNQEMTFQIQRIYTKDISFEAPNAPQVFQKEWQPEVKLDLDTSSNTLAENVYEVILRVTVTATMEEETAFLCEVQQAGIFTVEGIEGTQLAHCLGAYCPNVLFPYARECITNLVGRGTFPQLNLAPVNFDALFMNYLQQQQQQDAANSGVEEA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.076 kDa

MTNGNGTPPEGAPPQLNVLAQYTKDLSFENPNAPASLAPQQQQPAINIQINVGANNVGENEYEVTLSIEGKAESGSSVLFSFELAYAGVFRVLNVPQENLHPLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFIGLYRQNLERAQQQGQPS

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.076 kDa

MTNGNGTPPEGAPPQLNVLAQYTKDLSFENPNAPASLAPQQQQPAINIQINVGANNVGENEYEVTLSIEGKAESGSSVLFSFELAYAGVFRVLNVPQENLHPLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFIGLYRQNLERAQQQGQPS

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.331 kDa

MAEVANNEAQAPQFNIQRIYTKDLSFETPNSPAVFQKEWNPEVKLDLDTRSNKLSDDTYEVILSLTVTAKNGEDTAFLCEVQQAGIFSIVGLTEQQLAHSLGAYCPNVLFPYARELVGNLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATEEATA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.664 kDa

MADEQQQVFQLQRIYLKDTSFECPGAPEVFLQEWKPKVNVQLNNSARRVGEGDEFEVEITVTVTAKDEAEEKTFYLVEVKQAGIFTVKGIDGEERAQLLGAYCPNLLFPYVREVVSDLVAKGSFPQMVLQPINFDALYQQQRDQQQGNAAAAGETVQ

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.327 kDa

MSENEQAAKAEAPIFHVVKLYLKDLSFESPNAPESFSVESEPKAEFNLDTKATQKDDDHYEVSLEVNVKVASGDGKILFMAEVSYGGLFMVKNVPSEHIPMVLGIDCPNILFPYVRQVISSVVLEGGYKPMVLDPINFAALFHHAQQQKAAQQGEKA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.233 kDa

MAEEQAAAQEQQPAFGIEKVYVKDLSLEIPHAPQIFIQREAPQVSIELSNATAQLEEGIYEVVVTVTVTSKIADKTVFLVEVAQAGIFQIRNVPQENIDIILGVTCPNIIFPYARETISDVVTRAGFPPVLLNPVNFEALYAQQKQEQAKANGATTH

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.096 kDa

MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKLDLDTRSAKLADDVYEVVLSLTVTAQNGGETAFLCEVQQAGIFSIAGLTEPQLAHSLGAYCPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAEEANA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.617 kDa

MAEEQQPRILLEVRKLYVGDLSVEVPNAPEVFQQSLNPEISLGINHENKKLKEENYYSVHLRLTVTAKDSTSSSVIYLVEATQTGIFEIVGLDESQLQHALNVYCTTVLYPYAREVISSAITHAGFPSLYLQPINFDALYQQQLQQEQNTTAQGGEA

secB

Protein-export protein SecB

157 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.372 kDa

MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDVKAERLADTVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTILFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEIAQQQGGAPNGTTLN

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.24 kDa

MSDENNQPFFNIQRIYLKDMSLEQPNSPAIFLEQEMPSVEVEVDVKAERLADTVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQIATQETGAGSAAHH

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.218 kDa

MSDENNQPFFNIQRIYLKDMSLEQPNSPGIFLEQEMPSVEVEVDVKAERLADTVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMGGQDGAAQNGVTH

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.232 kDa

MSDENNQPFFNIQRIYLKDMSLEQPNSPGIFLEQEMPSVEVEVDVKAERLAETVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTILFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMGGQDGAAQNGVTH

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.286 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQEWQPEVKLDLDTASSQLADDIYEVVLRVTVTASLGEETAFLCEVQQGGIFTVGGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQTEGEGAAQHQDA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

16.959 kDa

MATQNGGPTQNAAPSLNVLAQYIKDFSFENPNAPRSLAAPPSQPDVNIQIHVNARPGGNGEFEVELKIDGGASIEGNTLFAFELVYAGVFRILNVPEESLQPVALIECPRLLFPFARQIIADAVRNGGFPPLMIDPVDFAALFQQRMQQEGQRIQA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.319 kDa

MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLDTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIDGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEGAEQRQDA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It specifically binds to its receptor SecA. Also required for the secretion of HasA via an ABC transporter system.

Belongs to the SecB family.

17.226 kDa

MSEQNSTEMAFQIQRIYTKDISFEAPNAPQVFQQEWQPEVKLDLDTASSQLADEVYEVVLRVTVTATLGEETAFLCEVQQAGIFSVAGIEGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEGAAPHQDA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.228 kDa

MSEQNSTEMAFQIQRIYTKDISFEAPKAPQVFQQEWQPEVKLDLDTASSQLADEVYEVVLRVTVTASLGEETAFLCEVQQAGIFSVAGIDGTQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQSEGEGAAPHQDA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.398 kDa

MAEEINNQEVQPEFHIQRVYTKDVSFEAPNTPHIFQKEWQPDVKLDMDTKTNILADSVYEVVLTLTVTCKLETETAFLCEVQQAGIFTIGNLPEPQLAHCLAAFCPNILFPYAREAVSNLVSKGSFPQLNLAPVNFDALFAQHMAQAQAQQATAEA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.356 kDa

MADEINNQEVQPEFHIQRVYTKDVSFEAPNTPHIFQKEWQPDVKLDMDTKTNILADGVYEVVLTLTVTCKLETETAFLCEVQQAGIFTIGNLPEPQLAHCLAAFCPNILFPYAREAVANMVSKGSFPQLNLAPVNFDALFAQHMAQAQAQQATAEA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.31 kDa

MAEAAQAQQQNFAIQRIFLKDVSFEAPNSPTMFQKEWNPDVKLDLDTQSRELGEGVYEVVLRLTVTVKNEEETAFLCEVQQGGIFTAGQMEEAQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQSQAQENAAAPSEA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.31 kDa

MAEAAQAQQQNFAIQRIFLKDVSFEAPNSPTMFQKEWNPDVKLDLDTQSRELGEGVYEVVLRLTVTVKNEEETAFLCEVQQGGIFTAGQMEEAQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQSQAQENAAAPSEA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.348 kDa

MSEQNNNEMAFQIQRIYTKDVSFEAPNAPKFFQQEWQPEIKLDLDTASSQLAEDTYEVVLRVTVTATLGEDTAFLCEVQQAGIFTISGIDGTQMAHCFGAYCPNILFPYARECITSQVSRGTFPQLNLAPVNFDALFMNYLQQQADGAGSQPAQEA

secB

Protein-export protein SecB

156 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.496 kDa

MAETNEKQAAHPEFRMQKMYTKDLSFESPSAPAVFLDGGSEPKVELNLQLNNKKVDDDHWEVSLEINAKVTADDGAKTLFILELEHAAIFWVRNIPEEHLAMVLAVDCPTLLFPFTRQIASQVSVDGGFAPFLMEPVNFMALFQGAKKQEQEQTAN

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.225 kDa

MAEAAQQDAQQNFAIQRIFLKDVSFEAPNSPDMFQKEWNPDVKLDLDTQSRELGEGVYEVILRLTVTVKNAEDTAFLCEVQQGGIFSASEMEAGQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQNQAQQAEGEQA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.257 kDa

MAEAAPQDTQQHFAIQRIFLKDVSFEAPNSPVMFQKEWNPDVKLDLDTQSRELGEGVYEVILRLTVTVKNAEETAFLCEVQQGGIFTAEKMEAGQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQQQAAQQGAEQA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.257 kDa

MAEAAPQDTQQHFAIQRIFLKDVSFEAPNSPVMFQKEWNPDVKLDLDTQSRELGEGVYEVILRLTVTVKNAEETAFLCEVQQGGIFTAEKMEAGQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQQQAAQQGAEQA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.007 kDa

MTDQQAPVFQIQRVYLKEASLEQPNSPAILLEQESPTVDIQLGVNAAPVAEGVFEVTVTATVQTKIKDKTVFLVEATQAGIFEIRNLPQEQMNQIMGIACPQIVYPYLRGNVADLVQRGGFPPVHLSEINFQAMFEQQQQQQAGAGADAPQLVTQ

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.225 kDa

MSEQNNNEMSFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVGGIEGNQLAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.259 kDa

MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.245 kDa

MSEQNNTEMAFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQAGIFSISGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.245 kDa

MSEQNNTEMAFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQAGIFSISGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.

17.245 kDa

MSEQNNTEMAFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQAGIFSISGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA

secB

Protein-export protein SecB

155 amino acids

One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA.

Belongs to the SecB family.