About Services Proteins Contact

sds22

Gene
SDS22
Protein
Protein phosphatase 1 regulatory subunit SDS22
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
338 amino acids
Function
Regulator of the mitotic function of yeast type 1 protein phosphatase.
Similarity
Belongs to the SDS22 family.
Mass
38.887 kDa
Sequence
MDKNSVNKDSEEKDERHKIEVVDDTNPDFITADSELTQDLPDDVEVIDLVHLKIKSLEDLNLYRFKNLKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLKSLKNLELGGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEGLEKNLKLTTLDVTSNKITSLENLNHLSNLTDIWASFNKIDQSFESLGENLSALSRLETIYLEGNPIQLENKTSYRRKLTMNLPPSLQKIDATYIRG

Gene
sds22
Protein
Protein phosphatase 1 regulatory subunit SDS22
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
332 amino acids
Function
Essential for the mitotic metaphase/anaphase transition. Positively modulates protein phosphatase-1, possibly by forming a repeating helical rod that is capable of enhancing a PP1-dependent dephosphorylation activity.
Similarity
Belongs to the SDS22 family.
Mass
38.067 kDa
Sequence
MSNVSSEDGIAPETQLIIDDPDVQQIDADEDLLDDVPDDVDCVELIQSRIQSMASLGLERFKNLQSLCLRQNQIKKIESVPETLTELDLYDNLIVRIENLDNVKNLTYLDLSFNNIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRVIENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLACLSHCLRELYVSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDELSGLKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQIDATIIPKTSKQFP