rusA

Crossover junction endodeoxyribonuclease rusA

131 amino acids

Endonuclease that resolves Holliday junction intermediates. Promotes DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity, though it can also cut branched DNA structures that lack the symmetry of Holliday junctions.

Belongs to the RusA family.

16.001 kDa

MKFEFEFELDKMPTTQQQKGIKKVKGKLQFYDRRGTNNYSLKAQLMKNKPKECFEKNVPLKLSVTFFYAIKQKKRWWQWKTSRPDLDNLMKNLQDYMTKLRYYSDDSQIVWLEAKKVNDEKNRIEIEITEV

rusA

Crossover junction endodeoxyribonuclease RusA

126 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides.

Belongs to the RusA family.

14.778 kDa

MISEMEEIELYLSKLPVPKSNRYIRPKGGKVFKPPRVTNWEARAIWELREQFKGDAIDYEISVDITLILPNRRKRDIDNMLKSLWDVMEKAGVIKNDNLIFEVHTVKKIEKGKEGVIIKIRPFQSP

rusA

Crossover junction endodeoxyribonuclease rusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates. Promotes DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity.

Belongs to the RusA family.

13.885 kDa

MNTYHITLPWPPSNNRYYRHNRGRTHISAEGQAYRDNVARIIKGSMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKASFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease rusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates. Promotes DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity.

Belongs to the RusA family.

14.067 kDa

MNEYQFVLPYPPSLNTYWRRRGSQYYISDKGQKYRKDVQQIIRQLKLDIFTKSRLRIKVIADVPDSRRRDLDNILKGLLDSLIHAGFAEDDEQFDDIRVIRGVKVPGGRLGIKITELESV

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.791 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRCRRDLDNLQKAAFDALTKAGFWLDDELVVDYRVVKMPVTKGGKLELTITELGDE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.773 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHISAEGQAYRDNVARIIKGSMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGKLELTITELGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.846 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.846 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.846 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of ruvAB or ruvC.

Belongs to the RusA family.

13.846 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.846 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE

rusA

Crossover junction endodeoxyribonuclease RusA

120 amino acids

Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC (By similarity).

Belongs to the RusA family.

13.89 kDa

MNTYSITLPWPPSNNRYYRHNRGRTHISAEGQAYRDNVTRIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE