rpsM

30S ribosomal protein S13

137 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.716 kDa

MARVLNVEIPNHKRIVIALCSIFGIGKSLATEIVEKTAKLQEEKFGKKFPILTENTKVKEINEEVLQVIRDVAKTYKTEGDLHREVQSNIKRLIEIKCYRGIRHRKGLPVRGQVTQKNARTRKGPRKTIMAKKDKGK

rpsM

30S ribosomal protein S13

137 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.716 kDa

MARVLNVEIPNHKRIVIALCSIFGIGKSLATEIVEKTAKLQEEKFGKKFPILTENTKVKEINEEVLQVIRDVAKTYKTEGDLHREVQSNIKRLIEIKCYRGIRHRKGLPVRGQVTQKNARTRKGPRKTIMAKKDKGK

rpsM

30S ribosomal protein S13

137 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.716 kDa

MARVLNVEIPNHKRIVIALCSIFGIGKSLATEIVEKTAKLQEEKFGKKFPILTENTKVKEINEEVLQVIRDVAKTYKTEGDLHREVQSNIKRLIEIKCYRGIRHRKGLPVRGQVTQKNARTRKGPRKTIMAKKDKGK

rpsM

30S ribosomal protein S13

132 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.048 kDa

MARILGVDIPNDKRVVISLTYIFGIGKSTSQQILKLANIDENIRVKDLADEQIAEIRRVALNFVKANGEKLQLEGDLRRTVAMDIKRLMEIGSYRGIRHRRGLPVRGQRTKTNARTRKGPRKTVANKKIETR

rpsM

30S ribosomal protein S13

132 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.048 kDa

MARILGVDIPNDKRVVISLTYIFGIGKSTSQQILKLANIDENIRVKDLADEQIAEIRRVALNFVKANGEKLQLEGDLRRTVAMDIKRLMEIGSYRGIRHRRGLPVRGQRTKTNARTRKGPRKTVANKKIETR

rpsM

30S ribosomal protein S13

132 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.034 kDa

MARILGVDIPNDKRVVISLTYIFGIGKSTSQKILKLANIDENIRVNDLADEQIAEIRRVALNFVKANGEKLQLEGDLRRTVAMDIKRLMEIGSYRGIRHRRGLPVRGQRTKTNARTRKGPRKTVANKKIETR

rpsM

30S ribosomal protein S13

132 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

15.002 kDa

MARILNIEIPSNKRVVISLTYILGIGKSLSKEIIVKANEKLAKAKEKTFTEDSRVKDLSEEQLQAIRDSAKTYLTEGDLRREVSLNIKRLMEIKCYRGIRHRKGLPVRGQVTQKNARTRKGPRKTVAGKKGK

rpsM

30S ribosomal protein S13

131 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.902 kDa

MARILGVEIPGNKPLISALPVIYGIGRSRAKLICEQAELNPQMRAKDLTNQQINRIIQVIEENGFVVEGDLRREIQQNIKRLQSIRCYRGIRHIRGLPVRGQRTSTNARTRKGPRKTIGVVRRKEAKKGKV

rpsM

30S ribosomal protein S13

130 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.853 kDa

MARVAGIDLPNNKRLDIALRYIYGIGPAISDEIIKELSLNPAKRVKDLTEEEVGRINNLITKNLKVEGDLRREVQSNIKRLIEIRSYRGLRHRRNLPVRGQRTKTNARTRRGKRKTVGAGKSTSSIKRVK

rpsM

30S ribosomal protein S13

129 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.779 kDa

MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKAIRVNKLTDEEINRLREIIDKEYRVEGDLRKEIALNIKRLIDIGCYRGNRHKHNLPVRGQRTKTNARTRRGPRKTVAGRGQKRGATKK

rpsM

30S ribosomal protein S13

129 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.838 kDa

MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKTIRVNKLTDEEINRLREIIDKEYRVEGDLRKEITLNIKRLIDIGCYRGIRHKHNLPVRGQRTKTNARTRRGPRKTVAGRGQKRGATKK

rpsM

30S ribosomal protein S13

129 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.838 kDa

MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKTIRVNKLTDEEINRLREIIDKEYRVEGDLRKEITLNIKRLIDIGCYRGIRHKHNLPVRGQRTKTNARTRRGPRKTVAGRGQKRGATKK

rpsM

30S ribosomal protein S13

129 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.371 kDa

MPRLLGVEIPAKKKVAYSLRYINGIGPTRADLLVKEAGLSPDMRAQDLTEEQLNKILHLITEHKWVLEGDLRREIAGNLKRLQAINCYRGVRHRRGLPVRGQRTSTNARTRKGPRKTVGVSKAAAAAKA

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.496 kDa

MARIAGVDLPREKRIEVSLQYIYGIGKTSAKLILERANVSPVTRTKDLTDDEVRRIRETIEQNVKVEGDLRREISLNVKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKKGLVRKAAAPAPMA

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.493 kDa

MARIAGVDLPREKRIEVSLQYIYGIGKTSAKLILERANVSPVTRTKDLTDDEVRRIRETIEQNVKVEGDLRREISLNVKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKKGLVRKAAAPAPKA

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.446 kDa

MTGEKSVARIAGVNIPTNKRVLIALQYIHGIGQKNAADILEKVKIPLDRRVNQLSDAEVLQIREVIDRDYLVEGDLRRETGMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.493 kDa

MARIAGVDLPREKRIEVSLQYIYGIGKTSAKLILERANVSPVTRTKDLTDDEVRRIRETIEQNVKVEGDLRREISLNVKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKKGLVRKAAAPAPKA

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.501 kDa

MARLAGVDLPPGKRAEIGLTYIYGIGRTRSKSLLHRAGIDFDKKIRDLTEDEINKVRTILEEEGAVEGDLRKEISMNIKRHIEMGSYRGLRHRRSLPVRGQRTHTNARTRKGPRRGTVANKKKATGKT

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.796 kDa

MARIVGVELPGNKKCFVALTYLYGVGRTRAFEILKNTGINPDKRVKDLTDEEVSKITKFIQDHYKVEGELRTDINRNIKRLIDIGCYRGFRHKLGLPVRGQRTRSNARTRKGPRPSRIKTKKKKEQTV

rpsM

30S ribosomal protein S13

128 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.762 kDa

MARIAGVDLPRDKRIEYALTLIYGIGWTTARKILERTGIDPWTKVRDLTDDEVQRLRDIIEKEMVVEGDLRRQVAMNIKRLIDIGCYRGLRHRMGLPVRGQRTRTNARTRKGPRPRIGVKKKGKQAGS

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.405 kDa

MARIAGVDLPKRKRVEIGLTYIYGIGRSTSRQILNKLSIDYDTKVDQLTETEINAIRNAVTNEHKVEGELRTEVSMNIKRLMDLGCYRGLRHRKSLPCHGQRTSTNARTRKGPKRTAVKKKGAAKKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.533 kDa

MARIAGVDLPRDKRVEIALTYLYGIGLSRSKEILANTGVNPDTRVKDLSDEDALALRSYIEANYQIEGDLRRWETMNIKRLVDIGTYRGRRHRQGLPVRGQRTRTNARTRRGRRLTVAGKKKAPSKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.545 kDa

MARIAGVDLPRDKRVEIGLTYLFGIGLSRSQEILAETGVNPDTRVRDLTDEEVANLRAYIETNYQIEGDLRRWEAMNIKRLADIGTYRGRRHRQGLPVRGQRTRTNARTRRGRRVTVAGKKKAPSKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.329 kDa

MARIAGVDLPKRKRIEIGLTYIFGIGRSTSSKILEELGIDPDTKTDDLTEGQVNDIRKLIDSKYRVEGELRTQISMNIKRLMDLGCYRGLRHRRGLPVHGQRTSTNARTRKGPRRAAVKKKGGAKKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.481 kDa

MPRLMGVDIPNDKQIQYSLTYLYGLGLYRAREVCEKLGIDPTSPASDISDEDVGRIAALLERDYLVEGPLRRQVTQNISRMREIKSYRGIRHRVSLPVRGQRTKTNARTRKGPRKTVAGKKGVKDLR

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.244 kDa

MARISGVDLPKKKRIEYGLTYIYGIGLFTSRKILDATGISYDKRVADLSEDEVAAIRKEIQEHYMVEGDLRKEVSMNIKSLMDLGCYRGLRHIKGLPVRGQKTKTNARTRKGKRKTVGAVSAAANKE

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.458 kDa

MARIAGVDIPREKRVEIALTYIFGIGPSRATQILLSTGINPNLRVRELTDVQVSLLREEIEQKYQVEGDLRRFENINIKRLMDIGCLRGRRHRLGLPVRGQRTRTNARTRRGGRKTVAGKKKAAAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.432 kDa

MARVAGVDLPRNKQARIALTYIYGIGNPRALRILTAANVDPFRKIQDLSEDEVNRIRQVIEAEGQVEGDLRKDVAMHIKRLIEIQSYRGLRHRRSLPVRGQRTHTNARTRKGPRRGTVAGKKKATKT

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.866 kDa

MARIAGVDIPRNKKIEIAITYIYGIGRSNGMEILRKANVNPERRVRDLTEEEVGRIREIVDREYRVEGDLRREVQLNIKRLMDIGCYRGLRHRRGMPVRGQRTRTNARTRRGRRGQAIGIKKKATKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.472 kDa

MARISGVDIPRNKRVEISLTYIYGIGRTTSTEILARTNINPNVRVKDLTEDEVIRLREIIDQDYTVEGDLRRAVQLNIKRLMDIGCYRGIRHRKGLPLRGQRTKTNARTRRGKKGAAIGGKKKATKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.38 kDa

MARIAGVDLPRDKRIEIGLTYIYGIGLSRSQEILAETDVNPDTRVKDLSDADVAAIRSEVQNNYEVEGDLRRLEAMSIKRLMDIGTYRGRRHRMGLPVRGQRTRTNARTRRGVRRTVAGKKKASAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.363 kDa

MARIAGVDIPRDKRVEIALTYIYGIGLTRSRQILAKTGINPDTRTRDLTDAEVAALRAVVEGEYQVEGDLRRQEAMNIKRLIDIGTYRGRRHRLNLPVRGQRTRTNARTRKGVRKTVAGKKKAPAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.35 kDa

MARIAGVDIPREKRVEIALTYIYGIGLTRSRQILAKTGINPDTRTRDLTDAEVAALRTVVEGEYQVEGDLRRQEAMNIKRLIDIGTYRGRRHRLGLPVRGQRTRTNARTRKGVRKTVAGKKKAPAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.679 kDa

MPRIEGVDVPDDKRGEIALTDIYGVGQSRASEILEKAEVSVDKRPREWTESETKRVRRIIEEDYTVEGQLRTEVQMNIKRLKEIGCYRGKRHREGLPVNGQRTRTNARTRKGKRKTVAGRSQSTQKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.379 kDa

MARIAGVDLPREKRIEVALQYIYGIGKTTAQAICHRANVDVTTRTKDLTDDEVRRIRETIEQAVKVEGDLRREISLNIKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKKGLVRKAAAPAPK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.866 kDa

MARIAGVDIPRNKKIEIAITYIYGIGRSNGMEILRKANVNPERRVRDLTEEEVGRIREIVDREYRVEGDLRREVQLNIKRLMDIGCYRGLRHRRGMPVRGQRTRTNARTRRGRRGQAIGIKKKATKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.252 kDa

MARIAGVDLPRNKYINIALTYIFGIGNSRAKAILAEANVEANRKVSDLNEEEVNRIRTAIENGSSVEGDLRKDVSMHIKRLIEIGSYRGYRHRRSLPVRGQRTHTNARTRKGPRKGTVANKKKATAK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.494 kDa

MARIAGVNIPQNKLVHIGLTYIYGIGNKFSSQICTSLEIPKAKRINELTDEDILKIREYIDANFKVEGDLRRDYSLTIKRLIDLACYRGSRHRKKLPVRGQRTRCNARTRKGKAIAIAGKKLTPLKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.439 kDa

MARIAGVEIPSNKRVVIALTYIRGIGIKKAQNILSDLKEIDINTKVEDLKEQHLIAIRNKIQNGNYLVEGDLKREVALNIKRLMENGSYRGLRHRKGLPSRGQNTRNNARTIKGKRRTKNTVANNKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.214 kDa

MARIAGIDLPPNKRAVISLQYIYGIGNKSAQDIIAAAGIDPTTRTKDLTEEQARKIREIIEASYKVEGDLRREVTMNIKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKRGIVRAKPAAPAR

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.572 kDa

MARIAGVDLPRDKRVEIALTYLYGIGLSRSHEILDATGVSPDVRVKDLSDEDALKLRTYIDENYEIEGDLRRWEAMNIKRLGDIGTYRGRRHRQGLPVRGQRTRTNARTRRGRRLTVAGKKKTPAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.546 kDa

MARISGVDLPRDKRVEIGLTYLYGIGLSRSQEILAETGVNPDTRVRDLSDEDVAKLRAYIENNYQIEGDLRRWEAMNIKRLADIGTYRGRRHRQGLPVRGQRTRTNGRTRRGRRVTVAGKKKAPAKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.421 kDa

MARIAGVDLPRDKRVEIALTYLYGVGLSRSQEVLSATGVNPDTRVKDLSDEDVAALRTYIETNYQIEGDLRRWEAMNIKRLADIGTYRGRRHRLGLPVRGQRTRTNARTRRGRRVTVAGKKKAPSKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.694 kDa

MARIAGVDLPRNKTIEIAITYIFGIGRSNGADVLRKANVNPATRVRDLTEEEVSRIREIVEREYRVEGDLRREIQMNIKRLMDIGCYRGLRHRKGLPVRGQRTRTNARTRRGRRGQAIGIKKKTLKK

rpsM

30S ribosomal protein S13

127 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.767 kDa

MARIAGVDLPRNKRIEIAITYIFGIGRSNGAEVLRKANVNPATRVRDLTEEEVSRIREIVEREYRVEGDLRREIQMNIKRLMDIGCYRGLRHRKGMPVRGQRTRTNARTRRGRRGQAIGIKKKTVKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.104 kDa

MARILGVDIPDNKRGEIALTYIFGIGRSSANQILAAAGVNKDKRVSSWTDEESQTIRTVINENYKVEGELKSEIRLNIKRLVDIGCYRGRRHVLGLPVRGQSTKNNARTRKGKRKTVANKKKAAKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.365 kDa

MARVSGVDIPREKRVEVALTYVFGIGRTLSQKTLAETGVNPNTRVRDLSEEELVRIREYVDNNFKTEGDLRREVQADIRRKVEIGCYQGLRHRRGLPVHGQRTSTNARTRKGPRRAIAGKKKPGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.219 kDa

MARVSGVDIPREKRVEIALTYVFGIGRTLSQQTLAATGVDPNTRVRDLSEEQLVAIREYVDNNIKTEGDLRREVQADIRRKVEIGTYQGLRHRRGLPVRGQRTSTNARTRKGPRRAIAGKKKPGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.245 kDa

MARVSGVDIPREKRVEVALTYVFGIGRTRSKEILASTGVNPNTRVRDLAEEDLVKIREHVDANLRTEGDLRREVQANIRRKVEIGCYQGIRHRRGLPVHGQRTSTNARTRKGPRRAIAGKKKPGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.106 kDa

MAIRIVGVDLPQNKRGEIALTYVYGIGRSSSAKILDKAGVDKDLKVKDWTDDQAAKIREIIGAEYKVEGDLRSEVQLNIKRLMDIGCYRGVRHRIGLPVRGQSTKNNARTRKGRKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.106 kDa

MAIRIVGVDLPQNKRGEIALTYVYGIGRSSSAKILDKAGVDKDLKVKDWTDDQAAKIREIIGAEYKVEGDLRSEVQLNIKRLMDIGCYRGVRHRIGLPVRGQSTKNNARTRKGRKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.12 kDa

MAIRIVGVDLPQNKRGEIALTYVYGIGRSSSAKILDKAGVDKDLKVKDWTDDQAAKIREIIGAEYKVEGDLRSEIQLNIKRLMDIGCYRGVRHRIGLPVRGQSTKNNARTRKGRKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.265 kDa

MARIAGVDLPRDKRVEIGLTYIYGIGLTRSQHILAETGVNPDTRIRELTDADISALRTAVEAYQVEGDLRRLENMNIKRLQDIGCYRGRRHRMGLPVRGQRTRTNARTRRGGRRTVAGKKKAPAKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.116 kDa

MARVAGVDLPREKRIEIALTYIYGIGLTRSKEVLAQTGISADTRVKNLTEAEQSTLRDAIEKTFKVEGDLRSEVGQNIKRLMDIGAYRGLRHRRGLPVRGQRTKTNARTRKGPKKTVAGKKKATRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.212 kDa

MARIAGVDLPREKRVEIALTYIYGIGLTRAKEVLARTGVNPDTRVKNLSETEQSALREAIEKTYKVEGDLRSEVGQNIKRLMDIGAYRGLRHRRGLPVRGQRTKTNARTRKGPRKTVAGKKKATRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.228 kDa

MARIAGIDLPREKRVEIALTYIYGIGLTRSKEILARTGVSPDTRVKNLSEAEQSTLREAIEKTYKVEGDLRNEVGQNIKRLMDIGAYRGLRHRRGLPVRGQRTKTNARTRKGPKKTVAGKKKATRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.11 kDa

MARIAGVDLPRDKRVEIGLTYIYGIGLSRAQEIIAATGVNPDTRVKDLSDADVTALRGEIESNYQVEGDLRRLESLNIKRLVDIGTYRGRRHRMGLPVRGQRTRTNARTRRGRRQTVAGKKKAPGK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.084 kDa

MARIAGVDLPRDKRVEIGLTYIYGIGLSRSQEIIAATGVNPDTRVKDLSDADVAALRGEVESNYQVEGDLRRLEAMNIKRLVDIGTYRGRRHRMGLPVRGQRTRTNARTRRGRRQTVAGKKKAPGK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.062 kDa

MAIRIVGVDLPQNKRGEIALTYIYGIGRSAAKSVLDKAGVDRDIKVKDWTDDQAAKVREVIGAEYKVEGDLRSEVQLNIKRLMDIGCYRGVRHRVGLPLRGQSTKNNARTRKGKKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.13 kDa

MARIAGVDLPRDKRIEIGLTYIYGIGLTRSQEILAATGVNPDTRVRELGDQDVAALRNAVAGYQVEGDLRRWESMNVKRLMDIGSYRGRRHRAGLPVRGQRTRTNSRTRRSAKRTVAGKKKAPSKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.399 kDa

MARLVGVDLPRDKRLEVALTYIYGIGRTRALETLAATGISPDLRVRDLTDDDLLKLREWIEANYRVEGDLRREVAADIRRKIEIGCYQGIRHRRGLPVRGQRTHTNARTRKGPRKTVAGKKKPGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.765 kDa

MARIAGVDIPRNKKIEIAITYIYGIGRSNGMDVLRKANVDPNRRVRDLTEEEVGRIREIIDREYRVEGDLRREVQLNIKRLMDIGCYRGLRHRRGMPVRGQRTRTNARTRRGRRGQAIGIKKKVKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.402 kDa

MARIAGVDLPDHKKLEVALTYIYGIGWSKAREVCEQTGIPSIKKLGELTPEELNQLRRYIEQNIKVEGDLRREVQLNIKRLVDIGTYRGLRHVRGLPVRGQQTKTNARTRKGRRKGTVANKKKVSK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.212 kDa

MARLVGVDLPREKRLEIALTYIFGVGRTRAKETLAATGVSPDLRVRDLSDDDLVALRDHIEGNYRVEGDLRREVAADIRRKVEIGTYQGLRHRRGLPVRGQRTKTNARTRKGPKRTVAGKKKAGRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.994 kDa

MAIRIVGVDLPQNKRGFIALTYIYGIGRSSAITILDKAGVDRDIKVKDWSDDQAAAIRDVIGAGYKVEGDLRSEVQLNIKRLMDIGCYRGIRHRIGLPLRGQSTKNNARTRKGKKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.994 kDa

MAIRIVGVDLPQNKRGFIALTYIYGIGRSSAITILDKAGVDRDIKVKDWSDDQAAAIRDVIGAGYKVEGDLRSEVQLNIKRLMDIGCYRGIRHRIGLPLRGQSTKNNARTRKGKKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.485 kDa

MAIVSGIEIPNNKIGLIALTYIFGIGISTSKRIFKDTGIDENIKVINWSDEDINKIRKYISSNIRIEGELRFEIQLDIKRMIEIGCYRGIRHRIGLPVRGQKTKNNCRTRKGKKKTVANKKKKINK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.268 kDa

MARLVGVDLPREKRLEIALTYIFGVGRTRALETLAATGISPDKRARDLTDEELVQLRNHIEANYKVEGDLRREVAADIRRKVEIGCYAGIRHRRGLPVRGQRTRTNARSRKGPKRTVAGKKKPGRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.299 kDa

MARLVGVDLPREKRLEIALTYIFGVGRTRALETLAATGISPDKRARDLTDEELVQLRDHIETNYKVEGDLRREVAADIRRKVEIGCYAGIRHRRGLPVRGQRTRTNARSRKGPKRTVAGKKKPGRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.084 kDa

MARIAGVDLPRDKRVEIGLTYIYGIGLSRSQEILAATGVNPDTRVKDLSDADVAALRGEVESNYQVEGDLRRLEAMNIKRLVDIGTYRGRRHRMGLPVRGQRTRTNARTRRGRRQTVAGKKKAPGK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.34 kDa

MARIAGVDLPNNKRLEVALTYIYGIGWSRAREICEKTGIPCTKRVGELTPDELNTLRKFIDENYKVEGDLRREVQLNIKKLKDMGCYRGIRHARGLPVRGQQTRTNARTRKGKRKTVGGTKKAKAK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.263 kDa

MARIAGIDIPSDKRVVIALTYIYGLGNKLSHKILNELKIDQNIRVKNLTEQQLSALRIEITKYNVEGDLRREVTLNIKRLMEIGAYRGLRHRKGLPVRGQKTRNNAHTVKGKPKAAIAGKKKNKVN

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.262 kDa

MAVRILGVDLPQNKRGEIALTYIYGIGCGLSSKILTEAGIDRDTRIKDWTDVQVAAVREIISRNFKVEGDLRSEIQLNIKRLMDIGCYRGIRHRIGLPLRGQSTKNNARTRKGKRKTVANKKRVTK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.587 kDa

MARLSGVDLPREKRVEIALTYIFGIGRTRSRETLAATGVNPDTRVRDLSEDEIVRLREWIDANYRVEGDLNREIKQDIRRKMEIGCYQGLRHRRNLPVHGQRTHTNARTRKGPRRAIAGKKKAGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.573 kDa

MARLSGVDLPREKRVEIALTYIFGIGRSRSRDTLAATAVNPDTRVRDLSEEEIVRLRDWIDANYRVEGDLNREIKQDIRRKMEIGCYQGLRHRRNLPVHGQRTHTNARTRKGPRRAIAGKKKAGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.546 kDa

MARLSGVDLPREKRVEIALTYIFGIGRSRSRDTLAATGVNPDTRVRDLTDDEVQKLREWIDANYRVEGDLNREIKQDIRRKMEIGCYQGLRHRRNLPVHGQRTHTNARTRKGPRRAIAGKKKAGKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.427 kDa

MARIAGVDLPRRKHVAYALPYLFGIGRTLALQICEKTNIPQNKRVEELSDAEVKAIRDLLDAEYKVEGDLRREVQLNIKRLMDLGCYRGLRHRRGLPANGQRTHTNARTRKGPRKGMLQRRPAATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.12 kDa

MAIRIVGVDLPQNKRGEIALTYVYGIGRSSSAKILDKAGVDRDVKVKDWTDDQAAKIREIIGAEYKVEGDLRSEVQLNIKRLMDIGCYRGVRHRIGLPVRGQSTKNNARTRKGRKKTVANKKKATK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.085 kDa

MARLVGVDLPRDKRLEVALTYIYGVGRTRAADTLKATGISPDLRVKDLGDAEIVALRDHLEGNYKIEGDLRREVAADIRRKVEIGSYEGLRHRRGLPVRGQRTKTNARTRKGPKRTVAGKKKAGRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.243 kDa

MARIAGVDLPRDKRIEIALTYIYGIGLTRSKEILAKTGVNPDTRTRDLTDADIAALRAAIDEYQVEGDLRRLEAMNIKRLMDIGCYRGRRHRLGLPVRGQRTRTNARTRRGSRRTVAGKKKPAAKK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.333 kDa

MARIAGVDLPRDKRVEVALTYVYGIGRSRAAETLANTGVNPDTRVYQLTEEELVKLREWIDANYKVEGDLRREVAADIRRKIEIGCYQGIRHRRGLPVRGQRTQTNARTRKGKKKTVAGKKKAGRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites (By similarity).

Belongs to the universal ribosomal protein uS13 family.

14.305 kDa

MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK

rpsM

30S ribosomal protein S13

126 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome structure it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the top of the two subunits; these bridges are in contact with the A site and P site tRNAs respectively and are implicated in movement during ribosome translocation. Separately contacts the tRNAs in the A and P sites.

Belongs to the universal ribosomal protein uS13 family.

14.305 kDa

MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.213 kDa

MARLFGTEIPNEKRIEASLPYIYGIGRSTSKRILEQAGINPDIRTGQLTDEQLTKIVQVITTDGILIEGDLRREKQSILKRLTSINCYRGQRHRRGLPVRGQRTRTNARTRKGKKKTVGAQAKKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.007 kDa

MARISGVDIPDNKRGEVSLTYIYGIGRNSAQSILTKAGVNWDKKVSEWNDDEANAVRAIIASEHKTEGALKSEVQLSIKRLMDIGCYRGLRHRKGLPVRGQRTKNNCRTRKGKRKTVANKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.126 kDa

MARIASVNIPDNKRLVVSLTYIYGLGPTMAAEICNKAKISKDKKVKELTDQELIGLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.084 kDa

MARIASVNIPDNKRLVVSLTYVYGLGPAMAAEICNKAKISKDKKAKELTDQELISLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.368 kDa

MARIAGVNIPTNKRVTIGLRYIYGIGETKAEEICRRLEIPAERRVNELSDDEILKIRELIDSEYRVEGDLRREVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGKAVAIAGKKKATR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.104 kDa

MARIAGVNIPTNKRVVIALRYVYGIGPSTAQSICNKLEIPDAKRVNELSDDEIVKIRELIDSELRVEGDLRRETAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGKAVAIAGKKKVTR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.348 kDa

MARIAGVNIPTNKRVAISLRYIYGIGPAQAQKICTELSIPDERRVNQLSDDEILRIRELIDREYRVEGDLRREVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGKAVAIAGKKKVTR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.241 kDa

MSRISNVNVPTNKRVMIGLTYIYGIGRSTAQKICQEVQVSVNKKVKDLSNQELVALRSIIESKYKVEGDLRREINLNIKKKKDIRCYEGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKPNK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.225 kDa

MARISNVNVPTNKRVMIGLTYIYGIGRSTAQKICQEVQVSVNKKVKDLSNQELVALRSIIESKYKVEGDLRREINLNIKKKKDIRCYEGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKPNK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.997 kDa

MARLAGVDIPREKRLEIALTYIYGVGKTRAHETLAATGISADVRVKDLTDAELVQLRDYIEGNYKVEGDLRREVAADIRRKVEIGSYEGLRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKAGR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.266 kDa

MARIAGVNIPSNKRVLISLRYIYGIGPAKAREICQSLEIGEDKRVNQLSEDEIMKIRELIDRDYRVEGDLRREVAMNIKRLVDLGCYRGLRHRKGLPVRGQRTHTNARTRKGKAVAIAGKKKATR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.071 kDa

MRLAGVNLPLNKHAVIALTHVYGIGRTSAENILRKAGIAYDKKISELSDEEAHAIREIIAEEYKVEGQARGEQQTAIKRLMDIGCYRGLRHRRSLPVRGQRTRTNARTRKGKRKTVAGKKKAVKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.034 kDa

MRIAGVNLPLNKHAVIALTHVYGIGRTSAENILQRAGIAPERKISELNDEEAHAIREIIAEDYKVEGQARGEQQTAIKRLMDIGCYRGLRHRRSLPVRGQRTQTNARTRKGKRKTVAGKKKATKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.122 kDa

MARLAGVDLPREKRLEVALTYIYGVGKTRAHKTLAETGISPDVRVKDLSDAELVQLRDYIEVNYKVEGDLRREVAADIRRKVEIGSYEGIRHRRGLPVRGQRTKTNARTRKGPKRTVAGKKKAGR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.961 kDa

MRIAGVNLPLNKHAVIALTHVYGIGKTSARNILERAGIDPAKKIAEMSDEEAHAIREIIAEEYKVEGQARGLQQLAVKRLMDIGCYRGLRHRRSLPVRGQRTQTNARTRKGKRKTVAGKKKAVKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.979 kDa

MARIAGVDLPRDKRAEIGLTYIYGIGPTRAKEILAKTGVSPDTRIKDLNDSEVAALRQVVENDYQVEGDLRRLEAMSIKRLMDIGTVRGRRHRAGLPVRGQRTRTNARTRRGARKTVAGKKKATR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.301 kDa

MARIAGVDLPRDKRIEIALTYVYGIGLSRAQEIIANTGVNPDTRVRDLSDEDALKLRSYVTDNYQVEGDLRRLESMNIKRLVDIGTYRGRRHRQGLPVRGQRTRTNARTRRGRRVTVAGKKKAPR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.979 kDa

MARIAGVDLPRDKRAEIGLTYIYGIGPTRAKEILAKTGVSPDTRIKDLNDSEVAALRQVVENDYQVEGDLRRLEAMSIKRLMDIGTVRGRRHRAGLPVRGQRTRTNARTRRGARKTVAGKKKATR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.152 kDa

MARIAGVDLPREKKVEIGLTYIFGIGRKTAQKILEASGVSSAQRVRDLNDNDLNKLRQEIERNHRVEGALRTEVAMNIKRLMDIGSYRGTRHRRGLPVRGQRTHTNARTKKGPRRAIAGKKKVTK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.997 kDa

MARLAGVDIPREKRLEIALTYIYGVGKTRAHETLAATGISADVRVKDLTDAQLVELRDYIEGNYKVEGDLRREVAADIRRKVEIGSYEGLRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKAGR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.874 kDa

MRIAGVNLPLNKHAVIALTHVYGIGNTTAKTILKRAGIAPDRKISDLNDAEAHAIRELVAEEYKVEGQARGEQQLAIKRLMDIGCYRGLRHRRSLPVRGQNTQTNARTRKGKRKTVAGKKKAARK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.806 kDa

MRLAGVNLPLNKHAVIALTYVYGIGNTSAKNILAKAGVAPDKKISELSDEEAHAIREIIGNEYTVEGEARAEQQLSIKRLMDIGCYRGLRHRRSLPARGQRTRTNARTRKGKRKTVAGKKKAGKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.991 kDa

MRIAGVNLPLNKHAVIALTHIYGIGKTSAKNILERVGIDPARKISELNDEEAHSIREVIAEDYIVEGQARGEQQLSVKRLMDIGCYRGLRHRRSLPARGQNTQTNARTRKGRRKTVAGKKKAVKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.976 kDa

MRIAGVNLPLNKHAVIALTHVYGIGKTSAKSILQRAGIAPERKISELNDEEAHAIREIIAEDYKVEGQARGEQQLAVKRLMDIGCYRGLRHRRSLPVRGQRTQTNARTRKGKRKTVAGKKKATKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.95 kDa

MRIAGVNLPLNKHAVIALTHVYGIGKTTAKTILQRTGIAPDRKISDLNDAEAHSIRELIAEEYKVEGQARGEQQLSIKRLMDVGCYRGLRHRRSLPVRGQNTQTNARTRKGKRKTVAGKKKAARK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.997 kDa

MRIAGVDLPRNKHVVIGLTYVYGIGRTTAKKILAKAGVPEDKKVSEVTDDEANEIRTIVTNEYKVEGQARSEQQLAIKRLMDIGCYRGLRHRRGLPARGQRTRTNARTRKGKRKTVAGKKKAGKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.834 kDa

MRLAGVNLPLNKHAVIALTYVYGIGNTSAKNILAKAGVAPDKKISELSDEEAHAIREIIGNEYTVEGEARAEQQLSIKRLMDIGCYRGLRHRRSLPVRGQRTRTNARTRKGKRKTVAGKKKAGKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.001 kDa

MRIAGVNLPLNKHAVIALTHVYGIGRASAESILQRAGIAPNRKISELNDEEAHAIREIIAEQYKVEGQARGEQQTAIKRLMDIGCYRGLRHRRSLPVRGQRTRTNARTRKGKRKTVAGKKKAVKK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.921 kDa

MARIAGVNIPNHQHAEIALTAIYGIGRARAREICEAAGINVSTKMKDVTDAEMDKLRDNVAKFVVEGDLRREVSMNIKRLMDLGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKAVRASSAKAGR

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.258 kDa

MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGINPDIRVKDLTDEQLITLRDYLEGNYKIEGDLRREIDADIRRKIQINCYQGQRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.23 kDa

MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGISPDIRVKDLTDEQLITLRDYLEANYKIEGDLRREVDADIRRKIQINCYQGQRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.23 kDa

MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGISPDIRVKDLTDEQLITLRDYLEANYKIEGDLRREVDADIRRKIQINCYQGQRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.245 kDa

MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGISPDIRVKDLTDEQLITLRDYLEANYKIEGDLRREIDADIRRKIQINCYQGQRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.038 kDa

MARISGIDLPSNKQLKIALTSIYGIGRTRALEVCNKADISSSKIAKDLDNDEVNRLRKVIESDYVVEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIASK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.037 kDa

MARISGIDLPSNKQLKIALTSIYGIGRTRALEVCNKSSISPSKIAKDLDNDEVNRLRKVIESDYVVEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIASK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.077 kDa

MARIAGVDLPSNKRIVIGLTYIFGIGKTSSQNILKKAGIDESIRVKDLSDEHEAAIRRVIEESYQVEGDLRSEVNLNIKRLMDVGCYRGFRHRRGLPVNGQRTRTNARTRKGVKKTVANKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.008 kDa

MARIAGIDLPREKRIVVGLTYIFGIGNSLSRVILKKAGIDESIRVKDLNESQEAAIRKALEESAKVEGDLRSEIQLNIKRLMDIGCYRGLRHRRGLPVNGQRTRTNARTRKGGKKTVANKKKVTK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.077 kDa

MARIAGVDLPSNKRIVIGLTYIFGIGKTSSQNILKKAGIDESIRVKDLSDEHEAAIRRVIEESYQVEGDLRSEVNLNIKRLMDVGCYRGFRHRRGLPVNGQRTRTNARTRKGVKKTVANKKKATK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.038 kDa

MARIAGIDLPREKRIVVGLTYIFGIGNSLSKLILKKAGIDESIRVKDLNESQEAAIRKTLEETAKVEGDLRSEIQLNIKRLMDIGCYRGLRHRRGLPVNGQRTRTNARTRKGGKKTVANKKKVTK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.038 kDa

MARIAGIDLPREKRIVVGLTYIFGIGNSLSKLILKKAGIDESIRVKDLNESQEAAIRKTLEETAKVEGDLRSEIQLNIKRLMDIGCYRGLRHRRGLPVNGQRTRTNARTRKGGKKTVANKKKVTK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.432 kDa

MARIVGVELPNNKKVWVALTYIYGIGRSRSFEILKNTGIDPEKRVGDLTDEEISKITKYIQDHFKVEGELRSEVERNIRRLIEIGCYRGIRHKLGLPVRGQKTRSNARTRKGPRPSRIKTKKKSS

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.418 kDa

MARIVGVELPNNKKVWVALTYIYGIGRSRSFEILKNTGVDPDKRVGELTDEEISKITKYIQDHFKVEGELRSEVERNIRRLIEIGCYRGIRHKLGLPVRGQKTRSNARTRKGPRPSRIKTKKKSS

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.432 kDa

MARIVGVELPNNKKVWVALTYIYGIGRSRSFEILKNTGIDPEKRVGDLTDEEISKITKYIQDHFKVEGELRSEVERNIRRLIEIGCYRGIRHKLGLPVRGQKTRSNARTRKGPRPSRIKTKKKSS

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.432 kDa

MARIVGVELPNNKKVWVALTYIYGIGRSRSFEILKNTGIDPEKRVGDLTDEEISKITKYIQDHFKVEGELRSEVERNIRRLIEIGCYRGIRHKLGLPVRGQKTRSNARTRKGPRPSRIKTKKKSS

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.078 kDa

MARISGIDLPNNKQLKIALTSIYGIGRTRALEVCNKSSISPSKIAKDLDNDEVNRLRKVIESDYIVEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIASK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.078 kDa

MARISGIDLPNNKQLKIALTSIYGIGRTRALEVCNKSSISPSKIAKDLDNDEVNRLRKVIESDYIVEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIASK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.169 kDa

MARIAGIDLPNNKQLQIALTSIYGIGRSRALEICKKTGILPEKRAKDLDNEEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIAAK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.16 kDa

MARIAGIDLPNNKQLQIALTSIYGIGRARALEICEKTGVLPDKRAKELDNDEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTKTNARTRKGKRKTVANKKMASK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.169 kDa

MARIAGIDLPNNKQLQIALTSIYGIGRSRALEICKKTGILPEKRAKDLDNEEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTKTNARTRKGKRKTVANKKIAAK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.243 kDa

MARIAGIDLPNNKQLQIALTSIYGIGRARALEICRKTDILPEKRAKDLDNDEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTKTNARTRKGKRKTVANKKMAAK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.213 kDa

MARIASVNIPDNKRLVVSLTYIYGLGTTMAKTICKKAKILEDKKVKDLTDQELISLRNIIENEYKVEGDLRREVTLNIKKKKDIRSYQGLRHIRKLPVRGQNTHSNARTRKGKAVAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.213 kDa

MARIASVNIPDNKRLVVSLTYIYGLGTTMAKTICKKAKILEDKKVKDLTDQELISLRNIIENEYKVEGDLRREVTLNIKKKKDIRSYQGLRHIRKLPVRGQNTHSNARTRKGKAVAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.096 kDa

MARIASVNIPDNKRLVVSLTYIYGLGPAMAAEICNKAKISKDKKVKELTDQELIGLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.126 kDa

MARIASVNIPDNKRLVVSLTYIYGLGPAMAAEICNKAKISKDKKVKELTDQELISLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.159 kDa

MARIASVNIPDSKRLVVSLTYIYGLGPTMAAEICNKAKISKDKKVKELTDQELISLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKTVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.145 kDa

MARIASVNIPDNKRLVVSLTYIYGLGSTMAAEICNKAKISKDKKVKVLTDQELISLRNIIENEYKVEGDLKREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKTVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.126 kDa

MARIASVNIPDNKRLVVSLTYIYGLGPTMAAEICNKAKISKDKKVKELTDQELIGLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.112 kDa

MARIASVNIPDNKRVVVSLTYIYGLGPTMAAEICNKAKISKDKKVKELTDQELIGLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.112 kDa

MARIASVNIPDNKRVVVSLTYIYGLGPTMAAEICNKAKISKDKKVKELTDQELIGLRNIIESEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKAVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.27 kDa

MARIASVNIPDNKRLVVSLTYIYGLGSTMAAEICNKAKISRDKKVKVLTDQELIRLRNIIENEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTHSNARTRKGKAIAIAGKKKTVK

rpsM

30S ribosomal protein S13

125 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.477 kDa

MARLAGVDLPREKRMEIALTYIYGIGRTRSKEILRATDISFDVRPKDLDDDQLAKLREALENYRLEGDLRREVQADIRRKIEIGCYQGLRHRRHLPVHGQRTKTNARTRKGPKKTVAGKKKAGKK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.156 kDa

MARIAGVDLPSNKKIEIALTYIYGIGRTTSKKILQATGVDPNKRVKDLTEEEISKLREEIENNYKVEGDLRQEVAANIRRLIEIGCYRGIRHKRGLPVRGQRTRCNARTRKGPRKTVGAKRKEK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.142 kDa

MARIAGVDLPSNKKVEIALTYIYGIGRTTSKKILQATGVDPNKRVKDLTEEEISKLREEIENNYKVEGDLRQEVAANIRRLIEIGCYRGIRHKRGLPVRGQRTRCNARTRKGPRKTVGAKRKEK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.204 kDa

MARLSGVDLPREKRMEIALTYIYGIGRTRSKEILDATGVSPDLRSKDLSDEDLAKLREYIEESLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.188 kDa

MARLAGVDLPREKRMEIALTYIYGIGRTRSKEILDATGVSPDLRSKDLSDEDLAKLREYIEESLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.188 kDa

MARLAGVDLPREKRMEIALTYIYGIGRTRSKEILDATGVSPDLRSKDLSDEDLAKLREYIEESLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.34 kDa

MARIAGVDLPREKRVEIALTYIFGIGLSRSKQILRDTGVDPNKRVKDLTDDEVAKIRDYIDKNFKVEGELRAEIARNIKRLIDIRCYRGLRHLRGLPVRGQRTRTNARTRKGPRKTVGVMRKKS

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.354 kDa

MARIAGVDLPREKRIEIALTYIFGIGLSRSKQILRDTGVDPNKRVKDLTDDEVAKIRDYIDKNFKVEGELRAEIARNIKRLIDIRCYRGLRHLRGLPVRGQRTRTNARTRKGPRKTVGVMRKKS

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.018 kDa

MARIAGVDIPKQKRGVIALTYIFGIGRSRAQEILAQAKVDESKKVSDWDDDEIGKIREAVGQFTIEGELRTEVQISIKRLMDIGCYRGIRHRAGLPLRGQRTKNNSRTRKGRRKTVANKKKATK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.194 kDa

MARLVGVDLPRDKRIEIALTYIYGIGRTRAQQVLEATGVNPDLRVHQLGDEELVKLRDEIEANFKIEGDLRREVQADIRRKIEIGSYQGRRHRQGLPVRGQRTKTNARTRKGPKRTVAGKKKAK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.752 kDa

MARIAGVDIPTQKRVVISLQYIYGIGQTTAQEVLKNANVSEDIRVKDLNDDQLSAIRGEVAKIVTEGDLRRESTLNIKRLMEIGSYRGIRHRKGLPVNGQNTRNNARTRKGKPKAVTGKKQAGK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.775 kDa

MARVAGVDIPGNKRVEIGLTYICGIGPTRSRHALTAAGISFDTRVKDLTDDQLVALRAHIQNSYRIEGDLRREVASDIRRKVEIGCYQGLRHRRGLPVNGQRTRTNARSSKGPRRTVAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.775 kDa

MARVAGVDIPGNKRVEIGLTYICGIGPTRSRHALTAAGISFDTRVKDLTDDQLVALRAHIQNSYRIEGDLRREVASDIRRKVEIGCYQGLRHRRGLPVNGQRTRTNARSSKGPRRTVAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.331 kDa

MARIAGVDLPRDKRIEAALPYIYGIGWSLSREILKKTGIDPDTRVRDLTEEQVAKLREVIDHEYKVEGDLQREVQMNIKRLIEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRRTVAGKKKAK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.176 kDa

MARIAGIDLPKNKRIEIALTYIYGIGRPTAQKILEQANIDGNTKSDDLTENQINSIRHVIDSHYKVEGDLRTEVSMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPRRSVMGKRKKA

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.383 kDa

MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTDDQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.383 kDa

MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTDDQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.322 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSNEILAATGIDRNLRTRDLTDDQLTHLRDYIEANLKIEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.309 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSNEILAATGIDRDLRTRDLTDDQLTHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.176 kDa

MARILGVDIPNNKRVVISLTYIFGIGKSRSQEILSKAKIDENKKVSALSEEELATIRKIASEYVIEGDLRREVAMNIKRLMEIGSYRGIRHRRNLPVRGQRTKCNARTRKGPRKTVANKKIETK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.18 kDa

MARILGIDIPNQKRIEIALTYIFGIGLSRSQAILKQANINPDKRVKDLTEEEFVAIRNVASAYKIEGDLRREIALNIKHLSEIGAWRGLRHRKNLPVRGQRTRTNARTRKGPRKTVANKKIESK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.218 kDa

MARLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTDDQVTVLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.33 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGIDRDLRTKDLTDDQVTQLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.33 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGIDRDLRTKDLTDDQVTQLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.33 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGIDRDLRTKDLTDDQVTQLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.134 kDa

MARVAGIDLPKNKRIDVALEYIYGIGKRNAKDVIAKANGQIDPTTRVKDLTEAQANLLNTILQKEYKVEGELRREISGNIQRYVDTGSYRGNRHRKRLPVRGQRTKTNSRTRKGKRRTVGSKTK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.935 kDa

MARISGVDLPREKRIEIGLTYVYGIGRVRASKILEEAGVNPDTRVKDLTDEEVAKIAKVIDADPEHLVEGDLRREVAMNIKRLKEIGCYRGIRHRKGLPCRGQKTKTNARTCKGPKKTVANKKK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.039 kDa

MARIAGVDIPKNKRGVIALTYIFGLGKSRAIEILEKAQVSQDKKVQDWNDDEIGAIRDAVSFYKIEGELRSEVSLNIKRLMDIGCYRGIRHRSGLPLRGQRTKNNSRTRKGKRKTVANKKKATK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.039 kDa

MARIAGVDIPKNKRGVIALTYIFGVGRSRAIEVLEKAQVSQDKKVQDWNDDEIGGIREAVSFYKIEGELRSEVSLNIKRLMDIGCYRGIRHRSGLPLRGQRTKNNSRTRKGKRKTVANKKKATK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.322 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSNEILAATGIDRNLRTRDLTDDQLTHLRDYIEANLKIEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.352 kDa

MARLMGVDLPRDKRMEIALTYIYGIGRTRSQEILEATGISRDMRTKDLTDDQVTQLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.017 kDa

MARILGVDLPRNKRVEIALTYIYGIGRPRAAMICKQVGIPSELRTEGLTDEHIAKIRSIVEANFKVEGDLRREIGQSIKRLMDLNCFRGIRHRKGLPVRGQNTRSNARTRKGPKKTVANKKKAV

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.149 kDa

MARIVGVELPDNKRIVFALPRIYGIGKSTAEDICEALGIDPMQKLGELTPEQINTLQDYITAHYKVEGDLRREVAMNIKRLMDIKCYRGIRHQRGLPVRGQRTRHNARTRKGPRKTVGAKKGKR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.144 kDa

MARLAGVDIPREKRVEVALTYIYGVGRTRALQTLRETEISGEIRVKDLTDEQLVSLRDYIEGNFKVEGDLRREVAADIRRKVEIGSYEGIRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.94 kDa

MARLAGVDIPREKRLEIALTYIYGVGKTRAHETLAATGISADVRVKDLTDAQLVELRDYIEGNYKVEGDLRREVAADIRRKVEIGSYEGLRHRKGLPVRGQRTKTNARTRKGPKRTVAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.309 kDa

MARLVGVDLPRDKRMEIALTYIYGVGRTRSNEILAATGIDRDLRTRDLTDDQLTHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.214 kDa

MARLVGVDLPRDKRMEIALTYIYGIGRTRSKEILAATGISPEQRSKDLTDDQVTQLREYIEATLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.351 kDa

MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.127 kDa

MARILGIDIPNNKRVEISLTYIYGIGKPRAQEILRKAKIDFNKRVKDLSDEELALIRSVASTYVLEGDLRRDVALNIKRLMEVGSYAGLRHRRGLPVRGQRTKSNARTRKGPRKTVANKKIESK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.051 kDa

MARILGIDIPNQKRIEIALTYIFGIGLSSAKTILKKAKINPDKRVKDLSEEELVAIRNAASGYKIEGDLRREIALNIKHLTEIGSWKGIRHRKNLPVRGQRTRTNARTRKGPRKTVANKKIESK

rpsM

30S ribosomal protein S13

124 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.321 kDa

MARLMGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGISRDQRTKDLTDDQVSQLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.097 kDa

MARIAGVDLPREKRVEVGLTYIFGIGRQTSNKILAATGINVDTRIKDLTEEEVNELRKLIDADYQVEGDLRREVSLNIKRLKEIRCYRGIRHTKGLPVRGQKTKTNARTRKGPKRTVGRKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.015 kDa

MARIAGVDLPRDKRVEVGLTYIFGIGRKTSNNILAAAGINPDTRIKDLTEEEVNNLRRIIDADHHVEGDLRREIALNIKRLKEIRCYRGIRHIKGLPVRGQKTKTNARTRKGPKKTVGRKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.026 kDa

MARIAGVDLPKNKRMDIALTYIFGIGRTTALRILESTGVDWTKNSDALTSEETNNIRKELEANYKVEGDLRREITAGIKRLMDIGCYRGLRHRRGLPCRGQRTHTNSRTRKGPRRGVMAKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.005 kDa

MARIAGVDLPKDKRAEIALTYIYGIGKPTAQKILAQTGVNPDTRIKDLTEEEVNKLRDYIDKNTKVEGDLRREVALNIKRLIEIGCYRGIRHRRGLPVRGQRTKTNARTRKGPKKTVGARRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.999 kDa

MARIAGVNIPTNKRVVIALTYIYGIGLSLANRICEGCNIDHNVRVVNLSDDEIIRIRNFIRENYIVEGDLRKEVSMNIKFLTDIGCYRGLRHRRGLPVRGQRTHTNAKTRKGRSKLPVAAKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.068 kDa

MARIAGVDLPKNKRLDIALTYIYGVGRTTALKILDTVGIDWTLKTDDLSGEQVNTIRKELEDNYKVEGDLRRDQIADIKRLMDIGCYRGLRHRRGLPVRGQSSKTNARTRKGPRRSVMSRKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.337 kDa

MARISGVDLPRDKRVEVALTYIYGIGRSSAKQLLEQVNVNPETRVRDLTEEEISRLRDLIDKEYKVEGDLRREVSLNIKRLIEIGSYRGLRHRRGLPVWGQRTRTNARTRKGPKKTVGVRRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.085 kDa

MARIAGVDLPREKRVEVGLTYIYGIGLPTAQKILARTGVNPETRIRDLSEEEVNRLREVIDKEIKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPIKTVGAKRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.085 kDa

MARIAGVDLPREKRVEVGLTYIYGIGLPTAQKILARTGVNPETRIRDLSEEEVNRLREVIDKEIKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPIKTVGAKRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.128 kDa

MARLMGVDLPREKRMEIALTYIYGIGRTRSKEILEATGVSPDLRSKDLSDDDLTKLRDYIEASEFKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKKTVAGKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.624 kDa

MARIAGIDLPRDKRIVIGLTYIYGIGNTTAEKVLAEAGVSEDVRVRDLSPEDEDKVRAAVDKLNLTLEGDLRREVSLNIKGLQEIASYRGIRHRRGLPVRGQHTKNNARTRKGPARAIAGKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.173 kDa

MARIAGVDLPRDKRVEIALTYIYGIGRPTANVILKKTGINPDTRVKDLTEEEVAKLRDEIEKNYKVEGELRREVALNIKRLIEIGCYRGIRHRKGLPVRGQRTRTNARTRKGPRRTVGVKRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.008 kDa

MARIAGIDLPRDKRIAIALTYIFGIGRPTADKILAETGINPDTRTRDLTDEEVARLREYIDKNVEVEGDLRREISLNIKRLMEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPARTVAGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.591 kDa

MARIAGIDLPRDKRIVIGLTYIYGIGNTTAQKVLAEAGVSEDVRVRDLTSDQEDAIRATVDKLNLQLEGDLRRKVSLDIKSLQEIASYRGIRHRKGLPVRGQNTKNNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.424 kDa

MARIGGVNVPVNKRVVVALTYIYGIGPSLASKICEGCGIGEDVLVSSLSDEDVVKIRNFIRSGCVVEADLRKEVAMNIKFLMDIGCYRGLRHRKKLPVRGQRTHTNARTRKGGTRLAVAVKKG

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.424 kDa

MARIGGVNVPVNKRVVVALTYIYGIGPSLASKICEGCGIGEDVLVSSLSDEDVVKIRNFIRSGCVVEADLRKEVAMNIKFLMDIGCYRGLRHRKKLPVRGQRTHTNARTRKGGTRLAVAVKKG

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.594 kDa

MARIGGVNVPVDKRVVVALTYIYGIGTSLANRICEGCGIDKNVRVSALSEEDVVKIRNFIRAGCVVEADLRKEVAMNIKFLMDIGCYRGLRHRKKLPVRGQRTHTNARTRKGGSRLAVAAKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14 kDa

MARIAGIDLPKEKRVEIGLTYIYGIGLTSSRKIIKATSVNPETRVKDLTEEEVNALRDYINKNFKIEGDLRREVALNIKRLVEIGCYRGIRHRRGLPVRGQKTKTNARTRKGPKKAVASKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.173 kDa

MARIAGVDLPRDKRVEIALTYIYGIGKPTSQKILAQSGVNPDTRVRNLTEEEINKLRDIIEKNYKVEGDLRREVALNIKRLIEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKTVGVRRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.092 kDa

MARIAGVDLPREKRAEIGLTYIYGIGKATANEILAKAEINPDTRIKDLSEDQVNELRKVIDDDFLVEGDLRREIALNIKRLRDIKCYRGIRHAKGLPLRGQRTKTNARTRKGPRKTVSRKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.013 kDa

MARIAGVNIPTNKRIVIALTYIYGIGLSLANRICEGCNIDHNVRVVNLSDDEIIRIRNFIRENYIVEGDLRKEVSMNIKFLTDIGCYRGLRHRRGLPVRGQRTHTNAKTRKGRSKLPVAAKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.029 kDa

MARIAGVNIPTNKRVVIALTYIYGIGISLANKICESCNIDHNIRVVNLSDDEIIRIRNFIRENYVVEGDLRKEVSMNIKFLTDIGCYRGLRHRRGLPVRGQRTHTNAKTRKGRSRLPVAAKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.029 kDa

MARIAGVNIPTNKRVVIALTYIYGIGISLANKICESCNIDHNIRVVNLSDDEIIRIRNFIRENYVVEGDLRKEVSMNIKFLTDIGCYRGLRHRRGLPVRGQRTHTNAKTRKGRSRLPVAAKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.116 kDa

MARIVGVEIPSNKKVHIALRYLYGIGPTRAMEICKNTGVDPDKRVKELTEDEISKIASFIQQNYKVEGELRTEVMRNIKRLMDIGCYRGLRHKLGLPVRGQRTRSNARTRKGPRPSRIKKKGK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.829 kDa

MRFLGVNLPDNKAVVVALTYLYGIGLPTARKICSSLAIDGSAKLPDLEQEQLNSIMAYIKNDIPFEGELRKSVAFSIKHLVDIKCYRGVRHRKNLPVRGQRTRTNARTRKGKVRVPIAAKKRV

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.975 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILKATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.976 kDa

MARISGIDLPKEKRVEIGLTYIYGIGLPTSQEILEATGVNPDTRVKDLSEEEVNAIRDYVNKNVKVEGDLRREIKLNIKRLVEIGSYRGIRHRRNLPVRGQKTKTNARTRKGPKRAIGGKKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.948 kDa

MARIAGIDLPKEKRVEIGLTYIYGIGLPTSQKILKETGVNSDTRVKDLTEEEVNLLRNYIKNLKIEGDLRREVALNIKRLIEIGSYRGIRHRKGLPVRGQKTKTNARTRKGPKKLVGAKKKSK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.948 kDa

MARIAGIDLPKEKRVEIGLTYIYGIGLPTSQKILKETGVNSDTRVKDLTEEEVNLLRNYIKNLKIEGDLRREVALNIKRLIEIGSYRGIRHRKGLPVRGQKTKTNARTRKGPKKLVGAKKKSK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.014 kDa

MARIAGIDLPKEKRVEVGLTYIYGIGINRSREILKETGVNPDTRVKDLSEEEVNTIRDYIGKNFVIEGDLRRTIALDIKRLVEIGCYRGIRHRRGLPVRGQKTKTNARTRKGPKRAISGKKNK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.046 kDa

MARIAGIDLPREKRVEVGLTYIFGIGTSSAKKILKETGVNPDIRIKDLSEEEVNLLRDYINQNLKVEGDLRRDVALDIKRLKEIGSYRGIRHRRGLPVRGQKTKTNARTRKGPKKLVVSRKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.168 kDa

MARIAGVDLPREKRVEIGLTYIFGIGRTLSNEILRKTGINPDTRVKDLTDEEISKLREVIDKEYKVEGDLRREIALNIKRLMEIGCYRGRRHRAGLPVRGQRTKTNARTRKGPKKTVGVQRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.575 kDa

MARIAGIDLPRDKRIVIGLTYIYGIGNTTAQKILAEAGVSEDVRVRDLSADQEDAIRATVDKLNLQLEGDLRRKVSLDIKSLQEIASYRGIRHRKGLPVRGQNTKNNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.996 kDa

MARLIGVDLPRDKRLEVALTYIYGIGRTRATETLKATGISGDLRVHELTDDQLVALRDHIEANYHVEGDLRREVAADIRRKIEIGTYQGRRHRSGLPVRGQRTRTNARTRKGKRKAVAKKKAK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

14.165 kDa

MARIAGVDLPRDKRVEVALTYIYGIGRPKSNMILAATGVNPDTRVRDLTEDEVNRLRDYIDKNVVVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRRTVGVRRKK

rpsM

30S ribosomal protein S13

123 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.951 kDa

MARILNIEIPNNKRVVISLTYIYGIGRTSAQEICAKAKIDENIRVKDLSEAQLSAIREIAKEYVTEGDLRREVSLNIKRLMEVKCYRGIRHRKGLPVRGQSTKSNARTRKGPRKTVAGKKSTK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.809 kDa

MARIAGVDLPREKRVEIGLTYIYGIGRVSADRILEAANVDPSTRVRDLTDDEVKRISAVIDETMTVEGDLRREIALNIKRLQEIGCYRGIRHRKGLPVRGQKTKTNARTRKGPKRTVANKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.764 kDa

MARIAGVNIPTAKRVVIALTYIHGIGPKFAQEIMDKVGIPAEKRVHQLTDAEVLQIREAIDRDYQVEGDLRRETSMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.854 kDa

MARIAGVNIPTAKRVVIALRYIHGIGPKFAQEICEKVGIPAERRVNQLTDAEVLQIRETIDRDYQVEGDLRRETSMNIKRLMDLGSYRGLRHRRSLPVRGQRTHTNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.725 kDa

MARIAGVNIPTAKRVVIALTYIHGIGPKFAQEIMEKVGLSADRRVHQLTDAEVLAIRETIDRDYQVEGDLRRDTAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.854 kDa

MARIAGVDLPRGKRVDIALTYIYGIGRATALQILDATGVNWTRNVDDLNADEVNEIRKEIEQNHKVEGDLRREISANIKRLMDIGCYRGLRHRRGLPVRGQRTHTNARTRKGPRRGTVGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.853 kDa

MARIAGVDLPRGKRVDIALTYIYGIGRTTALQILDVTGVDWSRNIDDLSADEVNEIRKELEQNHKVEGDLRREISSNIKRLMDIGCYRGLRHRRGLPVHGQRTHTNARTRKGPRRGAVGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.854 kDa

MARIAGVDLPRGKRVDIALTYIYGIGRATALQILDATGVNWTRNVDDLNADEVNEIRKEIEQNHKVEGDLRREISANIKRLMDIGCYRGLRHRRGLPVRGQRTHTNARTRKGPRRGTVGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.81 kDa

MARIAGVDLPRGKRVDIALTYIYGVGRATALEILDTTGVDWTRNIDDLSADEVNEIRKEIEQNHKVEGDLRREISSNIKRLMDIGCHRGLRHRRGLPARGQRTKTNARTRKGPRRGVAGKRK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.902 kDa

MARIAGVDLPRNKHVEIALTYIYGIGRTRSQQILEKVGINPTLKSDALTEEQVNDIRKVIDSDFKVEGELRTQISMNIKRLMDLGCYRGLRHRKSLPCRGQRTSTNARTRKGPKRAAVKKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.922 kDa

MARIAGVDLPRGKRVDIALTYIYGIGRTTAMKILDTTGVNWERSIDDLSADEVNEIRKELEQHYKVEGDLRREVSSNIKRLMDIGCYRGLRHRRGLPVHGQRTHTNARTRKGPRRGAVGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.845 kDa

MARIAGVNIPTAKRVVIALQYIHGIGPKKAEEITEKVGIPAERRVNQLTDAEVLQIREAIDRDYIVEGDLRREVSMNIKRLMDLGCYRGLRHRKQLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.845 kDa

MARIAGVNIPTAKRVVIALQYIHGIGPKKAEEITEKVGIPAERRVNQLTDAEVLQIREAIDRDYIVEGDLRREVSMNIKRLMDLGCYRGLRHRKQLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.886 kDa

MARIAGVNIPTNKRVVIALQYIHGIGPKKAEEITEKVGIPAERRVNQLTDAEVLQIREAIDRDYIVEGDLRREVAMNIKRLMDLGCYRGLRHRRNLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.875 kDa

MARIAGVNIPTAKRVVIALQYIHGIGPKKAEEITEKVGIPAERRVNQLTDAEVLQIRETIDRDYLVEGDLRREVSMNIKRLMDLGCYRGLRHRKQLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.916 kDa

MARIAGVNIPTNKRVVIALQYIHGIGAKKAEEITQKVNIPAERRVNQLTDAEVLQIRETIDRDYLVEGDLRREVSMNIKRLMDLGAYRGLRHRKQLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.872 kDa

MARIAGVNIPTNKRVVIALQYIHGIGPKKAEEITEKVGIPAERRVNQLTDAEVLQIREAIDRDYVVEGDLRREVAMNIKRLMDLGCYRGLRHRRNLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.863 kDa

MARIAGVNIPTNKRVVIALQYIHGIGSKKAEEICAKVNIPDARRVSELTDAEVLQIRETIDRDYLVEGDLRREVAINIKRLMDLGCYRGLRHRRQLPVRGQRTHTNARTRKGKAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.822 kDa

MARIAGVNIPTAKRVVIALTYIHGIGTKFAQEIIEKVGIPAERRVHQLTDAEVLQIRETIDRDYQVEGDLRRETSMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPAKAIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.

13.789 kDa

MARIAGVNIPTQKRVEIALQYIHGIGAAKAKEICGKVGIPVERRVHQLTDDEVLRIREVIDSDYKVEGDLRREVAMNIKRLMDMACYRGLRHRKGLPVRGQRTHTNARTRKGPAKPIAGKKK

rpsM

30S ribosomal protein S13

122 amino acids

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.

Belongs to the universal ribosomal protein uS13 family.