rpsL

30S ribosomal protein S12

147 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

16.294 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRNKAVLNTGRNVQKDNRRGIRENES

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.916 kDa

MPTINQLVRKPRKRVTKKVKAPALRFSLNVLKGKLTRGKGSPFKRGVCTQVRTMTPKKPNSALRKIARVRLSNGMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAQGVANRKQGRSKYGTKKASAVPAKKK

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.916 kDa

MPTINQLVRKPRKRVTKKVKAPALRFSLNVLKGKLTRGKGSPFKRGVCTQVRTMTPKKPNSALRKIARVRLSNGMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAQGVANRKQGRSKYGTKKASAVPAKKK

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.804 kDa

MPTINQLVRKGREDKVVKSKSPALQKGYNSFKKSQTNQSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIGGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVNNRKQGRSKYGTKRPKPGQAAAKK

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.751 kDa

MPTVNQLVRKGRSSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.765 kDa

MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK

rpsL

30S ribosomal protein S12

144 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.765 kDa

MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK

rpsL

30S ribosomal protein S12

142 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.425 kDa

MPTFNQLVRKGRKAAKKKSTAPALQKGFNSLKKVQTDISCPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAAGVAKRMQGRSKYGAKRPKSSAAAK

rpsL

30S ribosomal protein S12

142 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.493 kDa

MPTFNQLVRKGRKVIEKKSNSPALQKGFNSKKKKPTDVNSPQKRGVCTVVKTSTPKKPNSALRKVARVRLTNGIEVSAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVAKRMQARSKYGAKRPKAGAASK

rpsL

30S ribosomal protein S12

142 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.895 kDa

MPTINQLVRKGREKRRKKSKAPALQFVYSRVGRNAGKLRQVPKGNPQKRGVCVAVRTMTPKKPNSALRKIARVRLTNGIEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAKGVENRRQGRSKYGTKKPKQ

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.781 kDa

MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVTSKSSPFKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTTGVDKRRQQRSAYGAKRPKADKKK

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.45 kDa

MPTINQLVRRGREKLKRKTKAPALDSCPQRRGVCVQVMTRTPKKPNSALRKVAKVRLTNGKEVIAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIIRGTLDASGAVGPSNTNKLNRNVSRSKYGVKRPKAGAKPASKAK

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.611 kDa

MPTISQLVTTSRQDKNYKSKSPALHYGFNSLKKEDSEYNSPQKRGVCTRVTTMTPKKPNSALRKYARVRLSNGTEVTAYIPGVGHSLQEHSVVLVRGGRVKDLPGVRYHIVRGALDATGVANRMQGRSKYGAKRPKAAKKK

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.627 kDa

MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTTKNPSPLKSGVCTRVGTMTPKKPNSALRKYAKVRLSNGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIVRGAGDASGVEKRRQQRSLYGAKRPKKEASK

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.627 kDa

MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTTKNPSPLKSGVCTRVGTMTPKKPNSALRKYAKVRLSNGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIVRGAGDASGVEKRRQQRSLYGAKRPKKEASK

rpsL

30S ribosomal protein S12

141 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.627 kDa

MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTTKNPSPLKSGVCTRVGTMTPKKPNSALRKYAKVRLSNGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIVRGAGDASGVEKRRQQRSLYGAKRPKKEASK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.441 kDa

MPTINQLVRKGRQSKVVKSDSPALNKGYNSFIKARTDISSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNTMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.423 kDa

MPTINQLVRKGRKSKVVKSDSPALNKGYNSFIKSQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.975 kDa

MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.46 kDa

MPTINQLVRKGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.5 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKRPKPAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.5 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKRPKPAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.5 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKRPKPAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.446 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.5 kDa

MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKRPKPAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.403 kDa

MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKEQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDAAGVANRMQGRSKYGAKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.51 kDa

MPTINQLVRKGREKKVFKSKSPALNKGYNSFKKEQTNVASPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLRGVRYHIIRGGLDTAGVANRMQGRSKYGAKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.491 kDa

MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKIQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVANRMQGRSKYGAKKPKESKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.466 kDa

MPTINQLVRKGRQKKVFKSKSPALNKGYNSFKKEQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVANRMQGRSKYGAKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.471 kDa

MPTFNQLVRKGRKTMEKNSQAPALQKGFNSLRKKTTDASAPQKRGVCTAVRTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKEAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.464 kDa

MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPRKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.34 kDa

MPTINQLVRKGRYVEEYKSTAPALQKGMNTLRKKATDISAPQKRGVCTSVKTVTPKKPNSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVANRQQSRSKYGAKKPKAAKK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.55 kDa

MPTINQLIRNGRSKIAKKSTAPAMQWGYNSLQRKQFASGGSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNTIEVSSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTQGVQKRMQARSKYGAKRPKKGK

rpsL

30S ribosomal protein S12

140 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.55 kDa

MPTINQLIRNGRSKIAKKSTAPAMQWGYNSLQRKQFASGGSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNTIEVSSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTQGVQKRMQARSKYGAKRPKKGK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.489 kDa

MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGTLDTQGVAKRSQGRSLYGVKRPKVKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.641 kDa

MATIAQLIRKPRQKKKVKSKSPALHYNLNLLNKKTTNVYSPLKRGVCTRVGTMTPRKPNSALRKYAKVRLTNGFEVLAYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDTVGVDKRRQQRSAYGAKKPKPKS

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.462 kDa

MPTISQLAKGCRVKKTWKSKVPALNMLYNSLHKKELKLSAPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGIEVNAYIPGEGHNLQEHSIVLIRGGKVKDLPGIRYHIVRGTQDTTGVAKRSQGRSKYGAKRPKKSK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.462 kDa

MPTISQLAKGCRVKKTWKSKVPALNMLYNSLHKKELKLSAPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGIEVNAYIPGEGHNLQEHSIVLIRGGKVKDLPGIRYHIVRGTQDTTGVAKRSQGRSKYGAKRPKKSK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.462 kDa

MPTISQLAKGCRVKKTWKSKVPALNMLYNSLHKKELKLSAPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGIEVNAYIPGEGHNLQEHSIVLIRGGKVKDLPGIRYHIVRGTQDTTGVAKRSQGRSKYGAKRPKKSK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.388 kDa

MPTINQLVSQGRKKKVWKTSSPALSLVYNSLNKKQTEIPAPFKRGVCTRVATMTPKKPNSALRKYARVKLSNGFEVTAYIPGEGHNIQEHSVVLIRGGRVKDLPGVRYTIVRGTQDAAGVANRNQSRSRYGTKKPKPKS

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.489 kDa

MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGTLDTQGVAKRSQGRSLYGVKRPKVKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.629 kDa

MATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVTNVYSPLKRGVCTRVGTMTPKKPNSALRKYAKVRLTNGFEVLTYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDTVGVEKRRQQRSAYGAKKPKAKS

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.503 kDa

MPTINQLVRKGRKSHKGKSKSPALGYVYNTFKKEEIKTPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVEGRMQSRSKYGAKKPKNKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.503 kDa

MPTINQLVRKGRKSHKGKSKSPALGYVYNTFKKEEIKTPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVEGRMQSRSKYGAKKPKNKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.522 kDa

MPTINQLIRKGRKAKVKKSDSPALNKGYNSFKKVQTDLSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQDRMQGRSKYGTKRPKDKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.433 kDa

MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVTSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKQSK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.496 kDa

MPTINQLIRKGRVDKVKKSDSPALNKGYNSFKKSQTDVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQNRMQGRSKYGTKKPKDKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.32 kDa

MSTVSQLIKKRRSSKTSKTKAPALSYGFNVLQKKNKHYSSPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLVRGGRVKDLPGVRYHIVRGALDATGVANRKQGRSKYGSKLPKEKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.277 kDa

MSTVSQLIKKRRSSKTSKTKAPALSYGFNVLQKKAKHYSSPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLVRGGRVKDLPGVRYHIVRGALDATGVANRKQGRSKYGSKLPKEKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.315 kDa

MPTVSQLIKKRRTSKTTKTKAPALSYGFNILKKKAQHYASPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLICGGRVKDLPGVRYHIIRGTLDATGVANRKQGRSRYGAKRPKAQK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.248 kDa

MPTINQLVRKGRKAVQEKSTAPALQKGFNSLKRKSTDLSAPQKRGVCTSVKTITPKKPNSALRKVARVRLTNGIEVSAYIPGIGHNLQEHSVVLIRGGRIKDLPGVRYHIVRGTLDTAGVANRMQGRSKYGAKRPKDKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.55 kDa

MPTINQLVRKPRQSKITKSKSPALNKGYNSFKKSLTDVKSPQKRGVCTRVGTMTPRKPNSALRKYARVRLTNQIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLAGVRYHIVRGALDTAGVNGRLQSRSKYGTKRPKEKK

rpsL

30S ribosomal protein S12

139 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.31 kDa

MPTINQLVKKPRTSKVKKSTAPALNKGYNSHKKKATDLASPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEVNAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVDGRMQGRSLYGAKKPKEKK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.274 kDa

MPTINQLVRKGRVSKVETSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKRPKKK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).

Belongs to the universal ribosomal protein uS12 family.

15.216 kDa

MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.244 kDa

MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKRPKAK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.185 kDa

MPTISQLINHGRSAKTSKSKAPALGMMFNSLQKKENKIPSPFKRGVCTRVATMTPKKPNSAIRKYARVRLSNGQEVTAYIPGEGHNLQEHSVVLIRGGKVKDLPGVRYTIVRGTQDAAGVDKRKQGRSIYGTKKPKEN

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.206 kDa

MPTIQQLVRKGRATFLKKGKAPALDSCPQKRGVCVRVYTTTPKKPNSAMRKVARVRLTNSKEVNVYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVSGRMQRRSKYGAKFPKTGTGKTKAVPTKNKK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.174 kDa

MPTINQLVRQGRKSISTKSDSPALNFGYNSKKKSLTNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGAKRPKKK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.174 kDa

MPTINQLVRQGRKSISTKSDSPALNFGYNSKKKSLTNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGAKRPKKK

rpsL

30S ribosomal protein S12

138 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.977 kDa

MPTISQLIRKGREVLTEKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGVEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGTQNRNQGRSKYGTKRPKKGAATAAKGPVKGKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.277 kDa

MPTINQLVRKPRKSKVEKSDSPALNKGYNSFKKTQTNVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQSRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.258 kDa

MPTINQLVRQGRKSKTYKSDSPALSRNFNSIKKSYTEANSPQKRGVCTSVRTMTPKKPNSALRKVARVRLTNGMEVLSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAAVQNRMQGRSKYGAKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.15 kDa

MPTINQLVTKGRKRKASKTKSPALNQSYNSLHKKYKKLSAPFKRGVCTRVATMTPKKPNSALRKYARVKLSNGMEVTAYIPGEGHNLQEHSVVLIKGASVKDLPGVRYSIIRGTQDAAGVNKRNQARSRYGAKKAKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.371 kDa

MPTTNQLVNRGRTSKVQKQNAPALSWSYNSLIKRSKKMPSPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGMEVTAYIPGEKHNIQEHSVVLIRGGRVKDLPGVRYHIVRGTQDVAGVNNRKQGRSLYGTKKDKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.098 kDa

MPTINQLIRKGRKSKGSKSNSPALNFGYNSYKKVQTNNSAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRMQSRSKYGAKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.136 kDa

MPTINQLVRKGRKSRTSKSDAPALNFGYNSMKKKATDNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVDGRMQSRSKYGTKRPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.1 kDa

MPTINQLVRKPRKSNATKSKSPALNFGYNSMKKKATNNVAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRMTSRSKYGTKAPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.107 kDa

MPTINQLVRKPRKSKVEKSDSPALNIGYNSHRKVHTKLSAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.077 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.077 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.09 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSLKRVPTNESAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.109 kDa

MPTINQLVRKPRKSKVEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.993 kDa

MPTIQQLVRKGREVLVEKSKSPALDSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNSKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPKAGQAAAPAKGKGKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.094 kDa

MPTTNQLVVNGRENKVRKQNAPALNLSFNTLTKSARKLPAPFKRGVCTRVATMTPKKPNSASRKYARVKLSNGMEITAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTQDLAGVANRKQGRSLYGAKKEKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.266 kDa

MPTINQLVRKGRVSKTKKSDSPALNKGYNSFKKRMTDQNAPQKRGVCTRVGTLTPKKPNSALRKYARVRLSNNMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRKQGRSKYGTKRPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.353 kDa

MPTINQLVRKPRKPRTFKSKVPALNFGYNSMSRKQTNNTAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNQYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVEGRMNGRSKYGAKRPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.861 kDa

MPTIQQLIRLGRSVKVSKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKVEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPKAGAPAAPVKGKGKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.091 kDa

MPTINQLVRKGRKSKSSKSDAPALNYGYNSFKKAQVKNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVTDRRQGRSKYGTKKPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.23 kDa

MPTINQLVRKGRKSHKGKSKSPALGFVYNSFKKEEIKNPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVDGRMQSRSKYGAKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.124 kDa

MPTINQLVRKPRRAQVTKSKSPAMNVGYNSRKKVQTKLASPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLMEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.124 kDa

MPTINQLVRKPRRAQVTKSKSPAMNVGYNSRKKVQTKLASPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLMEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.124 kDa

MPTINQLVRKPRRAQVTKSKSPAMNVGYNSRKKVQTKLASPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLMEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.19 kDa

MPTINQLIRKGRKSKVSKSNAPALNFGYNSYKKVATNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVEDRRQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.423 kDa

MPTISQLIRKRRVDKIVKTKAPALSYGFNNLKNKVQKYKSPQKSGVCIRVTTMTPKKPNSALRKYARVRLSNGTEVNAYIPGIGHTLQEHSVVLIRGGRVKDLPGVRYHIIRGILDAKGVINRKQSRSKYGSKKNKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.182 kDa

MPTINQLVRKPRKSKVEKPKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPRKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.153 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPRKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGHVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.086 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.149 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.077 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.103 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.161 kDa

MPTINQLVRKPRKSKVKKSKSPALNVGYNSRKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLTNLIEVTAYIPGIGHNLQKHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.057 kDa

MPTINQLVRKPRQSKVVKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.057 kDa

MPTINQLVRKPRQSKVVKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.057 kDa

MPTINQLVRKPRQSKVVKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.077 kDa

MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKIAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.144 kDa

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.052 kDa

MPTIQQLVRKGREQLVFKSKSPALDSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGALDTAGVNGRKQSRSKYGAKRPKPGQAAAAPAKGKKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.1 kDa

MPTINQLVRKPRKSKVSKSKSPALNFGYNSMKKKATNNAAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRMTSRSKYGTKAPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.184 kDa

MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.337 kDa

MPTINQLVKTNRKAKTWKTKAPALNRGVNSLKKKVTKVSAPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTQAVNNRKQSRSLYGAKRPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.177 kDa

MPTINQLVRKGRRSQSSKSKAPALNYGYNSMKKSQVNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVTDRKQSRSKYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.343 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.287 kDa

MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.309 kDa

MPTINQLVRKPRKSKAKKSDSPALNKGFNSMKKQFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVEGRMQSRSLYGTKRPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.288 kDa

MPTINQLVRKPRKSKTKQSDSPALNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEVNAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.344 kDa

MPTINQLVRKPRKSKTKQSDSPVLNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEVNAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.344 kDa

MPTINQLVRKPRQSKSKKSDSPVLNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.36 kDa

MPTINQLVRKPRQSKSKKSDSPALNRNFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKK

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.107 kDa

MPTINQLVRKPRKSKVEKSDSPALNIGYNSHRKVHTKLSAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

137 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.107 kDa

MPTINQLVRKPRKSKVEKSDSPALNIGYNSHRKVHTKLSAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG

rpsL

30S ribosomal protein S12

136 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.048 kDa

MPTIQQLIRSERQELKKKTKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGAKRPKPGAASTASTGKKR

rpsL

30S ribosomal protein S12

136 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.905 kDa

MPTIQQLVRKGRETLVEKGKSPALDACPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNGKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKRPKPGQAAAAAKGKKK

rpsL

30S ribosomal protein S12

136 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.832 kDa

MPTIQQLIRLGRSVKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPKAGVPAPVKGKGKR

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.911 kDa

MPTIAQLIRRERGIAQRKTKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKNRMQSRSKYGTKRPKPGQAAAPAGKKR

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.826 kDa

MPTINQLVRKGREKVEKKSKAPALQGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLSNGYEVTCYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVKDRKQSRSKYGAKRPKPGQAAATTGKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.804 kDa

MPTIQQLIREERKAAVRKTKAPALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGAKRPKPGQAPAAAGKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.793 kDa

MPTIQQLIREERSVAARKTKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGAKRPKPGQAPAAAGKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.61 kDa

MPTIQQLIRSGRSIKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPKAGAAAPAKGKGR

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.737 kDa

MPTIQQLIRSGRSIKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPKAGAAAPVKGKRR

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.014 kDa

MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRKQSRSKYGTKKD

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.927 kDa

MPTINQLVRKGRHSKTTKSKSPALNYSYNSMKKEQVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLTEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRKQARSKYGAKKG

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.927 kDa

MPTINQLVRKGRHSKTTKSKSPALNYSYNSMKKEQVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLTEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRKQARSKYGAKKG

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.927 kDa

MPTINQLVRKGRHSKTTKSDSPALNYAYNSMKKKMNYNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRKQGRSKYGAKKG

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.014 kDa

MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRKQSRSKYGTKKD

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.927 kDa

MPTINQLVRKGRHSKTTKSDSPALNYAYNSMKKKMNYNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRKQGRSKYGAKKG

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.581 kDa

MATIQQLIRKGRKKIKYNSKSPALGGCPQRRGICTKVTTMKPRKPNSSMKKVAKVRLSNGKEVNVYIPGEGHNLQEHSAVLIQGGGVNDLPGINYRIIRGTLDTAGVNGRIQSRSRYGAKKGAAKQAAAAKSKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.106 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.106 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.079 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDSKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).

Belongs to the universal ribosomal protein uS12 family.

15.106 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

15.106 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).

Belongs to the universal ribosomal protein uS12 family.

15.106 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

rpsL

30S ribosomal protein S12

135 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.706 kDa

MPTVNQLIKEGREKIKKKSKAPALQGNPQKRGVCVRVYTVTPKKPNSALRKVARVRLSNGIEVTCYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTAGVANRRQSRSKYGAKRPKAGAAQATKGGKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.504 kDa

MPTINQLVKHGREKVKEKSKSPALQGHPQKRGVCVRVSTMTPKKPNSALRKIAKVRLSNGIEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVENRRQSRSKYGAKRPKAGAAAGAKGKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.684 kDa

MPTINQLIRKERKKAIKKSKSPALVNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIPGEGHNLQEHSIVLIRGGRVKDLPGVKYHIIRGALDTAGVQKRNVSRSKYGAKKGKAGAAPTTGKKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.749 kDa

MPTINQLVRRARKDVVEKSKAPALKSNPFKRGVCTRVYTTTPKKPNSALRKVARIRLTNQLEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDASGVNGRNQSRSKYGTKRPKPGQAAAGGKKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.797 kDa

MPTIQQLVRKGRESFADKSKSPALNSCPQRRGVCVRVYTTTPRKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKRPKPGQAPAAKGKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.769 kDa

MPTIQQLVRKGRESFADKSKSPALNSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKRPKPGQAPAAKGKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.585 kDa

MPTTQQLLRKGRTTLQKKSKVPALKGSPFRRGVCTVVKTTTPKKPNSALRKIARVRLSSGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTQGVKDRNKSRSKYGTKKPKAGAAAAGAKKK

rpsL

30S ribosomal protein S12

134 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.898 kDa

MPTIQQLIRQERELLKRKTKSPALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGAKRPKPGEAAATGKKK

rpsL

30S ribosomal protein S12

133 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.747 kDa

MPTIQQLVRKGREVLVEKSKSPALDSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNQKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPKPGQAAPAKKK

rpsL

30S ribosomal protein S12

133 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.747 kDa

MPTIQQLVRKGREVLVEKSKSPALDSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNQKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPKPGQAAPAKKK

rpsL

30S ribosomal protein S12

133 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.747 kDa

MPTIQQLVRKGREVLVEKSKSPALDSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNQKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPKPGQAAPAKKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.567 kDa

MPTISQLIRQGREAARYKTASPALKSCPQRRGVCVRVYTTTPKKPNSALRKVCRVRLSNQMEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGTLDASGAAGPSSTNKATRNRKRSKYGVKRPKA

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.465 kDa

MPTIQQLIRHGRSVKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRQSRSKYGAKQPKEGGAAKGKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.436 kDa

MPTIQQLIRHGRSMKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKVPKAGAAPAKKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone (PubMed:11014182, PubMed:11007480, PubMed:11163189, PubMed:11014183, PubMed:11511350, PubMed:11296217, PubMed:11228145, PubMed:11228145, PubMed:11283358, PubMed:11340196, PubMed:11866529). Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (PubMed:11283358).

Belongs to the universal ribosomal protein uS12 family.

14.599 kDa

MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).

Belongs to the universal ribosomal protein uS12 family.

14.599 kDa

MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).

Belongs to the universal ribosomal protein uS12 family.

14.599 kDa

MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK

rpsL

30S ribosomal protein S12

132 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.344 kDa

MPTINQLVRKERKKVTVKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVARSKYGAKRPKAGAAAAAKK

rpsL

30S ribosomal protein S12

131 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.23 kDa

MPTFSQLVRKGRTAPRYKTASPALQGSPQRRGVCTRVYTQTPKKPNSALRKVARVRLTNGIEVTTYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHVVRGTLDSVGVANRKQGRSKYGAKRAKGGAAAGKK

rpsL

30S ribosomal protein S12

131 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.707 kDa

MPTIQQLVRKGRKNIKKKSKSMALNCCPQRKGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTAGVKDRKKARSKYGAKCSKKINKINKK

rpsL

30S ribosomal protein S12

131 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.404 kDa

MPTINQLITNGRKGIIKKTKSPALKNCPQRRGVCTRVYTVTPRKPNSALRKVARVRLTSGYEISSYIPGEGHNLQEHSLVLIRGGRIRDLPGVRYHIIRGTLDTAGVDGRKQGRSKYGAKKAKVAKTASAK

rpsL

30S ribosomal protein S12

131 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.354 kDa

MPTTQQLLRKGRKVLQKKSKVPALKGSPFRRGVCTVVKTTTPKKPNSALRKIARVRLSSGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTQGVKDRNKSRSKYGTKKPKAGAAAAKK

rpsL

30S ribosomal protein S12

131 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.301 kDa

MPTINQLVRNERKKVTVKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGAAAPKK

rpsL

30S ribosomal protein S12

130 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.562 kDa

MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDNKKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.267 kDa

MPTINQLIRKERKKVIRKTKSPALLECPQRRGVCTRVYTTTPKKPNSALRKVAKVKLTSKVEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIIRGALDTAGVAKRNVSRSKYGAKKAKAGGDKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.291 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAPRKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.254 kDa

MPTYNQLVRFGRKSKTRKSKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDISGVKGRKQGRSRYGAPCKQIAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.344 kDa

MPTYNQLVRFKRKSKVRKTKSPALEANPFKSGVCLVVKTVTPKKPNSALRKVATVRLSNKRTVNVYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHVVLGAYDIAGVKGRKQGRSRYGAPRKQVVATKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.345 kDa

MPTYNQLVRFERKSKVRKTKSPALEANPFKSGVCLVVKTVTPKKPNSALRKVATVRLSNKRTVNVYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHVVLGAYDIAGVKGRKQGRSRYGAPRKQVVATKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.222 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAPSKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.291 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAPRKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.291 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAPRKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.303 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAHRKQVAATKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.321 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGTPRKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.291 kDa

MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAPRKQVAVTKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.279 kDa

MPTYNQLVRFGRKSKIRKTKSPALESNPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGATRKQVAATKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.237 kDa

MPTIQQLIRHGRSVKVSKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDTSGVSDRKQSRSKYGAKQPKAVAAKK

rpsL

30S ribosomal protein S12

129 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.169 kDa

MPTIQQLIRHGRSMKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPKAGAAKK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.169 kDa

MPTINQLIRKGREPKERKSKSPALMGNPQKRGVCIRVTTMTPKKPNSALRKVARVRLTNGVEVWAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVEGRKQGRSKYGTKRPKEGGKK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.181 kDa

MPTINQLIRKGREPKERKSKSPALMGNPQKRGVCIRVTTMTPKKPNSALRKVARVRLTNGIEVWAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVEGRRQGRSKYGAKRPKEGGKK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.213 kDa

MPTIQQLIRRGRKTKASKTASPALERCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRNSRSKYGAKRPKEAAAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.196 kDa

MPTIQQLVRDGRYTKSFKTASPALDRCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNGIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRNGRSKYGAKRPKEGAKK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.069 kDa

MPTIQQLIRRGRTTKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRQGRSKYGAKRPKGAAAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.076 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGTAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.046 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGAAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.046 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGAAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.046 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGAAK

rpsL

30S ribosomal protein S12

128 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.046 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAGAAK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.09 kDa

MPTIQQLVRTGRTQITKKSKSVALDSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTSGVAGRTQRRSKYGAKRPKEAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.12 kDa

MPTIQQLVRIGRTKMTKKSKSVALDSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTSGVAGRTQRRSKYGAKRPKEAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.24 kDa

MPTIQQLIRDERSKAKRKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDATGVKNRQKARSKYGTKRPKPAAK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.943 kDa

MPTINQLVRKGRKQVIKKSKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVKGRVHSRSKYGTKKADAGKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.119 kDa

MPTINQLVRKERKKVIDKSKSPALKKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTTGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNNRTVSRSKYGTKRPKAAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.375 kDa

MPTIQQLIRNEREQARQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPKEAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.362 kDa

MPTIQQLIRTEREKARQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPKEAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.83 kDa

MPTINQLVRQGRKKLTEKSASPALKGNPFKRGVCTVVKTTTPKKPNSALRKIARVRLSNNIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVANRMQGRSKYGAKRPKAGKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.1 kDa

MPTINQLVRKGRITPEEKSKSRALHSCPQRRGVCLQVMTRTPKKPNSALRKVAKVRLTNGEEVIAYIGGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDCLGVDKRRQGRSKYGAKRPKAAAK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.362 kDa

MPTIQQLIRTEREKARQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPKEAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.061 kDa

MPTINQLIRYGRKPKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGAKRPKDQKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.061 kDa

MPTINQLIRYGRKPKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGAKRPKDQKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.061 kDa

MPTINQLIRYGRKPKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGAKRPKDQKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.075 kDa

MPTINQLVRKERKKVIVKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKDAKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.988 kDa

MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKAAAK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.103 kDa

MPTINQLIRQPRVSARVKSKSPALENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDTQGVKDRKQARSKYGTKRAKAGKK

rpsL

30S ribosomal protein S12

127 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.103 kDa

MPTINQLIRQPRVSARVKSKSPALENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDTQGVKDRKQARSKYGTKRAKAGKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.741 kDa

MPTISQLVRKGRKTVASKSTAPALKECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVANRMQGRSKYGAKKPKQKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.071 kDa

MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVNDRKQGRSKYGTKKPKDKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.071 kDa

MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVNDRKQGRSKYGTKKPKDKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.071 kDa

MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVNDRKQGRSKYGTKKPKDKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

14.071 kDa

MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVNDRKQGRSKYGTKKPKDKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.741 kDa

MPTISQLVRKGRKTVASKSTAPALKECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVANRMQGRSKYGAKKPKQKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.

13.741 kDa

MPTISQLVRKGRKTVASKSTAPALKECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVANRMQGRSKYGAKKPKQKK

rpsL

30S ribosomal protein S12

126 amino acids

Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Belongs to the universal ribosomal protein uS12 family.