rppH

RNA pyrophosphohydrolase

238 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

27.745 kDa

MLDREGFRPNVGIILINARNEVFWGKRIGEHSWQFPQGGIKYGETPEQAMYRELHEEVGLLPEHVRIVGRTRDWLRYEVPDKFIRREIRGHYRGQKQIWFLLRMVGRDCDIQLRATEHPEFDAWRWSQYWVPLDAVIEFKREVYQMALSELSRFVQRSHRAPLSPYGRGGPHRERDGRDNRAGGQAGRNDQNTRGQRQPPTLMVTTSTVIVETVITSRPAAQPIDSSNPDDTPSKDSL

rppH

RNA pyrophosphohydrolase

235 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

27.39 kDa

MLDREGFRPNVGIILINARNEVFWGKRIGEHSWQFPQGGIKYGETPEQAMFRELHEEVGLLPEHVRIVGRTRDWLRYEVPDKFIRREIRGHYRGQKQIWFLLRMVGRDCDIQLRATEHPEFDAWRWSQYWVPLEAVIEFKREVYQLALSELSRFVQRQTRAPLSPYGRGGQHRERDGRDARDSRERSSDQGGRNEQHAQPALTVTTTTVIVETVSVSAPTPSSPNPDDTAPKDNS

rppH

RNA pyrophosphohydrolase

235 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

27.431 kDa

MLDRDGFRPNVGIILLNQRSQVFWGKRIRTHSWQFPQGGIDRGENPEQAMFRELHEEVGLHPQHVQVLARTRDWLRYEVPDRFIRRDARGHYKGQKQIWFLLQLVGHDWDLNLRATNHPEFDAWRWNDYWVPLDVVVEFKRGVYEMALTELSRFVPRCEFRFDARPEQRNRYLRGGLHQRDLLANQSGEPGSFPAAGGIPSYATRPGAPFELPPGATFEPDPQTSFGVNAPTKKT

rppH

RNA pyrophosphohydrolase

231 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.722 kDa

MLDREGFRPNVGIILINARNEVFWGKRIGEHSWQFPQGGIKYGETPEQAMYRELHEEIGLLPEHVRIVGRTRDWLRYEVPDKFIRREIRGHYRGQKQIWFLLRMAGRDCDVHLRATEHPEFDAWRWSDYWVPLEAVIEFKRDVYQLALTELSRFLNRNPRVPLSPYGVHHGRHGSGQRYAQQPGQPPTLAQRRPLQPVTQVAPVAPAAEAVQAVESDAVLPATPAPNPTES

rppH

RNA pyrophosphohydrolase

231 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.798 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPVQAMYRELHEETGLLPEHVKVIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDCVIEFKRDVYQLALTELSRFLRRPQPRTERPGGHHHGQRYPRMASSVNAPPGASMASSMTVTTVTTAIAVESTLRATIESDCSSTEDPAVQAPGLRD

rppH

RNA pyrophosphohydrolase

229 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.849 kDa

MLDRDGFRPNVGIILLNQKNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMFRELHEEVGLMPNHVRVVARTRDWLRYEVPDRYIRRDARGHYKGQKQIWYLLQLMGHDWDLNLRATDHPEFDAWRWNDYWVPLDVVVEFKRGVYEMALTELARFLPRGEQQRNRYLRSGMRPREAHETGPETYGAPGLHPARSGSFRVNPGMELPPGACFDPDPQSGQQQVLHPDPGKA

rppH

RNA pyrophosphohydrolase

229 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.821 kDa

MLDRDGFRPNVGIILLNQRNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMFRELHEEVGLLPPQVRVIARTRDWLRYEVPDRFIRRDARGHYKGQKQIWYLLQLLGHDWDLNLRATNHPEFDAWRWNDYWVPLDVVVEFKRGVYEMALTELARFLPRHEQRNRYLRSGMRTREHESSGQASLARTSSLLVKPGMELPPGASFDPDPQNSVPAPLEALPTLPVPKKPLDA

rppH

RNA pyrophosphohydrolase

229 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.847 kDa

MLDRDGFRPNVGIILLNQRNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMFRELHEEVGLLPPQVRVIARTRDWLRYEVPDRFIRRDARGHYKGQKQIWYLLQLLGHDWDLNLRATNHPEFDAWRWNDYWVPLDVVVEFKRGVYEMALTELARFLPRHEQRNRYLRSGMRTREHESSGQASLPRTSSLLVKPGMELPPGASFDPDPQNSVPAPLEALPTLPVPKKPLDA

rppH

RNA pyrophosphohydrolase

228 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

In the C-terminal section; belongs to the Nudix hydrolase family. RppH subfamily.

26.73 kDa

MEKRSGIGRLYQGSFFNRYSRAGGNPGAPSVRCARVRGDDGVLVFTPFGNDRRGTSSTTMKQWVKMMNDIVIDKRGFRLGVGMVIMNRQGELLWGRRVGNPDAWQFPQGGLLPNETLREALNRELDEEVGLSPHDVIYLRETRQWISYRLPKKFRRPEHRGPVCIGQRQKWFLLQFTGKDDAISLDHCSQPEFDQWRWVDYWYPVDHVVEFKRDVYQKVLTEFAEFIR

rppH

RNA pyrophosphohydrolase

227 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.076 kDa

MLDREGFRPNVGIILLNARNEVFWGKRIGEHSWQFPQGGIKYGETPEQAMYRELHEEIGLLPEHVRIVGRTRDWLRYEVPDKFIRREIRGHYKGQKQIWFLLRMAGRDCDIHLRATEHPEFDAWRWSHYWVPLEAVIEFKRDVYQMALTELSRFLNRHPRVPLSPYGTHGAHGAHGVHGRHGGPRGQALSRAQAAQQADADGNAEVPGAADYVSPATPVSTTRSTDD

rppH

RNA pyrophosphohydrolase

226 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.39 kDa

MLDRDGFRPNVGIILLNQRNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMFRELHEEVGLQPCHVRVVARTRDWLRYEVPDRYIRRDARGHYKGQKQIWFLLQLVGHDWDLNLRATNHPEFDAWRWNDYWVPLDVVVEFKRGVYEMALTELARFLPRNDQRNRYLRSGMRQREGAPEVSLGTTTQLRTTSLLVHPGMELPPGASFDPDPRTGDGDPGMPGIHKPAG

rppH

RNA pyrophosphohydrolase

224 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.004 kDa

MLDREGFRPNVGIILLNARNEVFWGKRIGEHSWQFPQGGIKYGETPEQAMYRELHEEIGLLPEHVRIVGRTRDWLRYEVPDKFIRREIRGHYKGQKQIWFLLRMAGRDCDIHLRATEHPEFDAWRWSHYWVPLEAVIEFKRDVYQLALTELSRFLNRHARVPLSPYGTHGPHGMHGRHGGPRSQALSRAQQAQQADADCNAEAAHATEHDSPATPVSTSRSTDD

rppH

RNA pyrophosphohydrolase

223 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.358 kDa

MLDRDGFRPNVGIILLNQRNQVFWGKRIRTHSWQFPQGGIDRGESPEQAMFRELHEEVGLHPEHVRIVARTRDWLRYEVPDRFIRRDARGHYKGQKQIWYLLQLIGHDWDLNLRATDHPEFDAWRWHDYWVPLDVVVEFKRGVYEMALTELARYLPRQDFRNRFLRSNVRAREFERHMPDGGAPAGLDLPPGGSFDPHPDITSASDDPSPPPHNKAPFLPSQR

rppH

RNA pyrophosphohydrolase

221 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

26.091 kDa

MLDRDGFRPNVGIVLLNQKNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMFRELHEEVGLLPDHVRVVARTRDWLRYEVPDRYVRRDARGHYKGQKQIWYLLQLVGHDWNLNLRATNHPEFDAWRWNDYWVPLDVVIEFKRSVYALALTELARYLPRHEPRNRYLRSGMRTRDGEHAGLFLTRVMSPKPGIQLPPGACFDPIPPTGMPDEREGLPFTAMPR

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.545 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRADKPQGPRPSSRYPRVIGTQSQQTLTIVDTSVVCSEIEVEASTLDEMPPRVIVGK

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.545 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRADKPQGPRPSSRYPRVIGTQSQQTLTIVDTSVVCSEIEVEASTLDEMPPRVIVGK

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.293 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASETPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.263 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVANGHAASEAPAAIDTSAVCSEVEPGANALDETPPRVSLRD

rppH

RNA pyrophosphohydrolase

216 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.362 kDa

MLDREGFRPNVGIILLNAHNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRTDKSRGPRAPRYPRVSNGHAASETPAVIDASAVCSEVEPGASTLDEIPPRLILRD

rppH

RNA pyrophosphohydrolase

215 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.479 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRLSRYPRVIGVQAQQTLTIVDTSVVCSEIEVEASTLDEMPPHVIVGK

rppH

RNA pyrophosphohydrolase

215 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.426 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMLGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRADKPRGPRLPRYPRVIAAQPAETLTIVDTSVVCSEVEVEASTLDEMPPRVIVGK

rppH

RNA pyrophosphohydrolase

215 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.49 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRPLRYPRIGGAPAQQTLTIVDTSVVCSEIEVEARTLDEMPPRVIIGK

rppH

RNA pyrophosphohydrolase

214 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.309 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRVSRYPRVIGAQAQTLTIVDTSVVCSEIEVEASTLDEMPPHVIVGK

rppH

RNA pyrophosphohydrolase

214 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.341 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRMSRYPRVIGAQAQTLTIVDTSVVCSEIEVEASTLDEMPPHVIVGK

rppH

RNA pyrophosphohydrolase

214 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.309 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRVSRYPRVIGAQAQTLTIVDTSVVCSEIEVEASTLDEMPPHVIVGK

rppH

RNA pyrophosphohydrolase

214 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.298 kDa

MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGETPMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRMVGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAEKPRGPRVSRYPRVIGAQAQTLTIVDASVVCSEIEVEASTLDEMPPRVIVGK

rppH

RNA pyrophosphohydrolase

213 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

25.205 kDa

MLDREGFRPNVGIVLLNQKNQVFWGKRIRTHSWQFPQGGIDRGETPEQAMIRELHEEVGLLREHIRIVARTRDWLRYEVPDRYIRRDARGFYKGQKQIWFLLQLVGHDWDLNLRATDHPEFDAWRWNDYWVPLDAVVEFKRGVYEIALTELARYLPRNELRNRFLRQGVRPHEQETTFDAVPGANFELPPGGSFEPNPQTSYGLDASGKPHET

rppH

RNA pyrophosphohydrolase

206 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.745 kDa

MIDPDGYRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELQEETGLLPEHVEVLGATPGWLRYKLPARAIRRNERQVCIGQKQVWFLLRLTGDESHVCLDHTDSPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQGVAGQGVTAMPKSAAEAWMPGHTAGHDRPRKRPRSRGYWPKKAQGDVPPT

rppH

RNA pyrophosphohydrolase

206 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.703 kDa

MIDPDGYRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELQEETGLLPEHVEVLGATPGWLRYKLPARAIRRNERQVCIGQKQVWFLLRLTGDESHVKLDHTDSPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLARGVAGQGVTAMPKSAAEAWMPGHTAGHDRPRKRPRTRGYWPKKATGDGPAS

rppH

RNA pyrophosphohydrolase

206 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

24.615 kDa

MIDFDGYRPNVGIVICNKAGQVLWAKRFGQNSWQFPQGGINEGENIETAMYRELYEEVGLTKKDVRLLWASKYWLKYKLPKRLVRSDGSQLVCIGQKQRWFLLQLLSDENLIDLKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFAGVLLNESKKPETVEKPRVERTEKRDFQKRDNQKREFRKSARMWNNSHQKGKAQ

rppH

RNA pyrophosphohydrolase

206 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

24.599 kDa

MIDFDGYRPNVGIVICNKAGQVLWAKRFGQNSWQFPQGGINEGENIETAMYRELYEEVGLTKKDVRLLWASKYWLKYKLPKRLVRSDGSQPVCIGQKQRWFLLQLLSDENLIDLKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFAGVLLNESKKPETVEKPRVERTEKRDFQKRDNQKREFRKSARMWNNSHQKGKAQ

rppH

RNA pyrophosphohydrolase

206 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

24.569 kDa

MIDFDGYRPNVGIVICNKAGQVLWAKRFGQNSWQFPQGGINEGENIETAMYRELYEEVGLTKKDVRLLWASKYWLKYKLPKRLVRSDGSQPVCIGQKQRWFLLQLLSDENLIDLKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFAGVLLNESKKPETVEKPRVERTEKRDFQKRDNQKREFRKSARTWNNSHQKGKAQ

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.675 kDa

MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQFTGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQSLAGPAAVGAMPERALEAWLPGSSAAGHDSPRKRPRKRNGARAMRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.647 kDa

MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQFTGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQSLAGPAAVGAMPQRALEAWLPGSSAAGHDSPRKRPRKRSGARAMRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.693 kDa

MIDPDGFRPNVGIVLMREDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQFTGQESHLKLDHTDSPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQTVAGPAAVGVMPQRALEAWLPGSSAAGHDRPRKRPRKRGGVLPVRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.693 kDa

MIDPDGFRPNVGIVLMREDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQFTGQESHLKLDHTDSPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQTVAGPAAVGVMPQRALEAWLPGSSAAGHDRPRKRPRKRGGVLPVRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.693 kDa

MIDPDGFRPNVGIVLMREDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQFTGQESHLKLDHTDSPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQTVAGPAAVGVMPQRALEAWLPGSSAAGHDRPRKRPRKRGGVLPVRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.729 kDa

MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLRFTGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPIAQNLAGPAAVGAMPERALEAWLPGSSAAGHDSPRKRPRKRSGARPMRINND

rppH

RNA pyrophosphohydrolase

205 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.729 kDa

MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLRFTGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPIAQNLAGPAAVGAMPERALEAWLPGSSAAGHDSPRKRPRKRSGARPMRINND

rppH

RNA pyrophosphohydrolase

203 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

24.203 kDa

MLDREGFRPNVGIILLNQRSEVFWGKRIRTHSWQFPQGGIKHGESPEQAMFRELHEEVGLFPDHVRIIARTRDWLRYEVPDHFIRRDARGHYKGQKQIWFLLQLTGRDSDMNLRATDHPEFDAWRWHDYWVPLEVVIEFKRNVYQMALTELARYVPRPNHHNRYLRSGMRAHRRDEGSEHNDHLDPTGPHDAGASVSEPKQAE

rppH

RNA pyrophosphohydrolase

200 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

24.115 kDa

MIDFDGYRPNVGIVICNKQGQVLWAKRFGQNSWQFPQGGINEGENIEQAMYRELYEEVGLAKKDVRLLWASKYWLRYKLPKRLVRNEQTQPVCIGQKQRWFLLQLVADEGAINLKTSKTPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFAQVLMGEQKKVESEKNRDNKEFTHERKEFRTQPKRELRKPYRVFKGKK

rppH

RNA pyrophosphohydrolase

199 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.427 kDa

MLDREGYRPNVGIVLLNSRNEVFWGKRVGQHSWQFPQGGIQHGESPEQAMYRELHEEVGLLPEHVQIIGRTRDWLRYDVPEEYLRRQHATRVHRAAYRGQKQIWFLLRLVGLDSDIQLRASEHPEFDAWRWVPFWIQLDAVIGFKREVYELALSELARYLSRGVRMHQLAWGSPLDLLQSFYSKGEEGSPESSKTDKSK

rppH

RNA pyrophosphohydrolase

199 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.951 kDa

MLDREGFRPNVGIVLLNQRNQVFWGKRIRTHSWQFPQGGIKYGETPEQAMYRELHEEVGLQPEHVRILARTRDWLRYEVPDHYIRREARGHYRGQKQIWFLLQLTGRDNDMNLRACDHPEFDAWRWNEYWVPLEVVIDFKRDVYQMALTELARFLPRANHHNRYLRSGMRAHRREDEERSNGEAPMEAADGETTPEGPR

rppH

RNA pyrophosphohydrolase

198 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.344 kDa

MIDFDGYRPNVGIVICNSKGQVLWAKRYGQNSWQFPQGGINDNESAEQAMYRELFEEVGLSPKDVKILYISKHWLRYKLPKRLLRYDSKPVCIGQKQRWFLLQLVSDEKNINMQSSKSPEFDGWRWVSFWYPVRQVVSFKKEVYRKAMKEFASVLFDGAKENLLSSKSNESDLKTHHTTKKSTFLTKHSKKHFHKSRG

rppH

RNA pyrophosphohydrolase

197 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.461 kDa

MIDFDGYRPNVGIVICNKVGQVLWARRFGQNSWQFPQGGINEGENIETAMYRELYEEVGLTKKDVRLLWASKYWLKYKLPKRLVRNDASQPVCIGQKQRWFLLQLVSDESAVNLKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMREFAAILLNETRKGETERSVLEASDKREYQRRETRKSARAWNHYPKGK

rppH

RNA pyrophosphohydrolase

197 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.378 kDa

MLDREGYRPNVGIVLLNSRNEVFWGKRVGQHSWQFPQGGIQHGESPEQAMYRELHEEVGLLPEHVQIIGRTRDWLRYDVPEEYLRRQNSTRVHRAAYRGQKQIWFLLRLVGLDSDIQLRAFEHPEFDAWRWVPFWIQLDAVIGFKREVYQLALSELARYLSRGMRMQQLAWGTPLDLFQSFYAGNEDQSKSSEKSDK

rppH

RNA pyrophosphohydrolase

197 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.86 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRYGQNSWQFPQGGINEGETPEQAMFRELFEEVGLQKKDVRVLYASKLWLRYKLPKRLLRHDSKPMCIGQKQRWFLLQLVCHEKEIDMHRTKSPEFDGWRWVSFWYPVRQVISFKRDVYRRAMKEFAQFLFDPTKNDTALFQHHETKKAETGKKQPYYHKYAPQNKKGRKRR

rppH

RNA pyrophosphohydrolase

197 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.628 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRYGQNSWQYPQGGINDGETPEQAMYRELYEEVGLTRRDVRIVYASKQWLRYKLPKRLLRYDSKPMCIGQKQRWFLVQLMSDEKNINMNCSKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKAMKEFACFLFDANKTVNPLSTNNNDEKKANYSAKKPYSPYRNQDKKRKTRV

rppH

RNA pyrophosphohydrolase

196 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.289 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRCGQNSWQFPQGGINDNESAEQAMYRELHEEVGLQPKDVRLLYVSKHWLRYKLPKRLLRYDSKPMCIGQKQRWFLLQLVGDEKNINMKTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFASVLFTDNPPIFSASREANSQSNSANKKYSQTKYTKRHFYKSKGQ

rppH

RNA pyrophosphohydrolase

196 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.475 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRCGQNSWQFPQGGINDNESAEQAMYRELHEEVGLQPKDVRLLYVSKHWLRYKLPKRLLRYDSKPMCIGQKQRWFLLQLVSDEKNINMQTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFASILFTDNPLIFSASREASLQHYSANKKYSQTKYTKRHFYKSRGQ

rppH

RNA pyrophosphohydrolase

196 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.506 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRCGQNSWQFPQGGINDNESAEQAMYRELHEEVGLQPKDVRLLYVSKHWLRYKLPKRLLRYDSKPMCIGQKQRWFLLQLVSDEKNINMQTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFASILFTDNPLIFSTSREANSQHYSANKKYSQTKYTKRHFYKSRGQ

rppH

RNA pyrophosphohydrolase

196 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.461 kDa

MIDFDGYRPNVGIVICNRKGQVLWAKRCGQNSWQFPQGGINDNESAEQAMYRELHEEVGLQPKDVRLLYVSKHWLRYKLPKRLLRYDSKPMCIGQKQRWFLLQLVSDEKNINMQTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFASILFTDNPLIFSASREANSLHYSANKKYSQTKYTKRHFYKSRGQ

rppH

RNA pyrophosphohydrolase

194 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.542 kDa

MLDREGFRPNVGIILINTRNEVWWGKRVREHSWQFPQGGIKFGETPEQAMYRELEEEVGLRAEHVKIIGRTRDWLRYEVPDHFIKREIRGHYKGQKQIWFLLRMVGRDCDVNLRMTEHPEFDAWRWHDYWVPLDVVIEFKRDVYQRALQELSRFLSRPTQHVPPQHNTARYLRQTHASRKPDEPSTEKTKPDNE

rppH

RNA pyrophosphohydrolase

193 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.251 kDa

MLDREGFRPNVGIILINAQNEVWWGKRVREHSWQFPQGGIKFGETPEQAMFRELEEEVGLRAEHVKIIGRTRDWLRYEVPDHFIKREIRGHYKGQKQIWFLLRMVGRDCDVNLRLTEHPEFDAWRWHDYWVPLDVVIEFKRDVYQRALQELSRFLSRPAHPAPIHNTARYLRQTHSARKTDEPSTEQTKPNNE

rppH

RNA pyrophosphohydrolase

192 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.164 kDa

MIDFDGYRPNVGIVICNAERQVLWAKRYGQNSWQFPQGGINDNETAEQAMYRELYEEAGLTPKDVEILYVSKHWLRYKLPKRLLRHDNRPICIGQKQRWFLLQLVSDEKRINMQHTKSPEFDGWRWVSFWYPVRQVVTFKKDVYRKVMKEFALFLFDTNLKSRLSVPEEKKMFSSVKKKLIHKKNHKYSSNQ

rppH

RNA pyrophosphohydrolase

192 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

23.164 kDa

MIDFDGYRPNVGIVICNAERQVLWAKRYGQNSWQFPQGGINDNETAEQAMYRELYEEAGLTPKDVEILYVSKHWLRYKLPKRLLRHDNRPICIGQKQRWFLLQLVSDEKRINMQHTKSPEFDGWRWVSFWYPVRQVVTFKKDVYRKVMKEFALFLFDTNLKSRLSVPEEKKMFSSVKKKLIHKKNHKYSSNQ

rppH

RNA pyrophosphohydrolase

191 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.133 kDa

MIDAEGYRLNVGIILSNDEGRVFWARRAGMRSWQFPQGGIKVDEDPDAAMFRELYEEVGLERQYVEIIARTKGWLRYQLPERFIRRRSYPLCIGQKQIWYILRLTGTDANIRLDCSERPEFDRWCWVDYWHPLSDVVYFKREVYRQALSELQRALQAGRPAGAQAVSDAGGTATRQIPVATEPSGPSSSQR

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.214 kDa

MIDPDGYRPNVGIVLIRRDGQVFWGRRVRRDGWQFPQGGMHSDETPVEAMYRELNEETGLLPEHVQLVGATPGWLRYRLPSQAVRCNRSQMCIGQKQVWFLLQLIGDESHVQLDQSENPEFDHWRWVSFWYPIEHVVMFKRSVYARALCQLASLAQQVVGLEVGTMPQYVQDICLLNVGYKHLPNWVSRY

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.678 kDa

MLDREGYRPNVGIILVNGKNEVFWGKRIREHAWQFPQGGIKYGESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDHFVRREWRGHYKGQKQIWFLLRLVGRDSDVCLRATQHPEFDAWRWSQYWVPLDAVIEFKRDVYTQALNELAVILFRRHHETRYLRQRVHGPRSTDSPSSETDGHAHIAG

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.705 kDa

MLDREGYRPNVGIILVNGKNEVFWGKRIREHAWQFPQGGIKYGESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDHFVRREWRGHYKGQKQIWFLLRLVGRDSDVCLRATQHPEFDAWRWSQYWVPLDAVIEFKRDVYTQALNELAVILFRRHHETRYLRQRVHGPRSTDNPSSETDGHAHIAG

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.678 kDa

MLDREGYRPNVGIILVNGKNEVFWGKRIREHAWQFPQGGIKYGESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDHFVRREWRGHYKGQKQIWFLLRLVGRDSDVCLRATQHPEFDAWRWSQYWVPLDAVIEFKRDVYTQALNELAVILFRRHHETRYLRQRVHGPRSTDSPSSETDGHAHIAG

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.12 kDa

MIDPDGYRPNVGIVLMCRDGQVFWGRRVRLDGWQFPQGGMHSDETPVEAMYRELNEETGLLPEHVQLLGATPGWLRYRLPSQAVRCNRSQMCIGQKQVWFLLQLIGDESHVQLDQSENPEFDHWRWVSFWYPIEHVVMFKRGVYARALCQLASLAQQVVGLEVGTMPQYVQDICLLNVGYKHLPNWVSRY

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.214 kDa

MIDPDGYRPNVGIVLMRRDGQVFWGRRVRRDGWQFPQGGMHSDETPVEAMYRELNEEIGLLPEHVQLVGATPGWLRYRLPSQAVRCNRSQMCIGQKQVWFLLQLIGDESHVQLDQSENPEFDHWRWVSFWYPIEHVVMFKRGVYARALCQLASLAQQVVGLEVGTMPQYVQDICLLNVGYKHLPNWVSRY

rppH

RNA pyrophosphohydrolase

190 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.214 kDa

MIDPDGYRPNVGIVLIRRDGQVFWGRRVRRDGWQFPQGGMHSDETPVEAMYRELNEETGLLPEHVQLVGATPGWLRYRLPSQAVRCNRSQMCIGQKQVWFLLQLIGDESHVQLDQSENPEFDHWRWVSFWYPIEHVVMFKRSVYARALCQLASLAQQVVGLEVGTMPQYVQDICLLNVGYKHLPNWVSRY

rppH

RNA pyrophosphohydrolase

187 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.221 kDa

MIDRNGYRANVGIILLNSKSQVFWGKRARQNSWQFPQGGIKSGETPTQAMYRELAEETGLQPVHVEILGRTREWLRYDVPACWTRRDWRKNYRGQKQIWFLLRMLGRDCDVSLKTCAHPEFDAWRWNQYWVELESVVEFKRQVYRLALTELSRLLDHETCLGNDQAYREPLEPVKELEEKSSDARQG

rppH

RNA pyrophosphohydrolase

187 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.271 kDa

MIDRNGYRANVGIILLNSQNQVFWGKRARQDSWQFPQGGIKSGETPTEAMYRELAEETGLQPVHVEILGRTREWLRYDVPACWTRRDWRKNYRGQKQIWFLLRLLGRDSDVSLETCAHPEFDAWRWNQYWVELESVVEFKRQVYRQALTELSRLLDHEAGLGNDRAYREPLEPVEKNRKKSSDTRQS

rppH

RNA pyrophosphohydrolase

187 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.134 kDa

MIDRNGYRSNVGIILLNSKNEVFWGKRIRQDSWQFPQGGIKPGESPEQAMYRELTEEVGLRPWHVQILGRTRDWLRYDVPAQWIKRDWRGNYRGQKQIWYLLRLLGSDCDVSLHTSGRPEFDAWRWNQYWVELESVVEFKRQVYRQALTELARLLNRPPVPFGYSGYEKYDYSASGPLTGSTAKQSE

rppH

RNA pyrophosphohydrolase

183 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

22.163 kDa

MIDREGYRPNVGIILCNARNQVFWGKRVNQHAWQFPQGGINAGETPEQAMFRELEEEVGLLPGHVRILGRTREWLRYDVPPHWTRRDNRGLYRGQKQIWFLLRLTGRDCDVSLRASAHPEFDAWRWNEYWVPMEAVVDFKREVYRLALEELERYLHRDLRYLRQHTRRPGERREVPFDLQLKP

rppH

RNA pyrophosphohydrolase

182 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.961 kDa

MLDREGYRPNVGIILCNGRNEVFWGKRIREHSWQFPQGGIKRGETPEEAMFRELYEEVGLLPEHVRILGRTKGWLRYEVPTHWIKREWRGSYKGQKQIWFLLRLVGRDSDVNLRATNKPEFDAWRWNDYWVPLDAVIEFKRLVYEQALNELVRFLDFDRKGPRHKKEQEPFSDVVDSVRSEE

rppH

RNA pyrophosphohydrolase

181 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.623 kDa

MIDTDGYRPNVGIIICNNNAQVLWAKRFGQHSWQFPQGGIKEGETPEQAMYRELYEEVGLKPEHVKLLATSRHWLRYKLPKRLVRWDSPDPVCIGQKQRWFLLQLISDEQQIEFEACGNPEFDAWRWVTYWYPVRQVVSFKCEVYRCALKEFSAVAFSLMKKSSDKKRNKRPRRASFYKKR

rppH

RNA pyrophosphohydrolase

181 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.094 kDa

MVDSDGFRPNVGIIVANDDGRVLWARRAGEDAWQFPQGGVEANETPLEALYRELREEVGLGPADVAVLGATRRWLRYRLPRRMIRRRGSRCIGQKQIWFLLRLLADEQRVRVDRVARPEFDRWRWVDYWYPVEEVIFFKRQVYRQALQELSGYLQADDWAGTGTEGGPAAVIPPAARRRLR

rppH

RNA pyrophosphohydrolase

181 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.11 kDa

MVDSDGFRPNVGIILANAAGQVFWARRIGQNAWQFPQGGIKAQETPEEALFRELEEEVGLAPADVEVMGCTRGWLRYRLPRRLIRSRSRPVCIGQKQVWFLLRLVGEEEQVQLDRSERPEFDHWRWVDFWHPVQEVVFFKRRVYTRALQELGPLLFPDGLPRQPPVGRPRRSAPPRGCRRA

rppH

RNA pyrophosphohydrolase

181 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.934 kDa

MIDRDGFRANVGLILCNQDDRVLWARRAREKAWQFPQGGVKESETTEEAAYRELEEEVGLGVEHVKIIGCTRSWLRYRLPNRYVRYGNKPLCIGQKQIWYLFRFVGEEQDVQLNLTDKPEFDYWCWVNYWYPLREIVYFKRKVYQRALNELAPLIFPDHQSLPPARSNYRKRRRQKTRSRI

rppH

RNA pyrophosphohydrolase

179 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.137 kDa

MIDSEGYRANVGIVITNDKQQVLLAKRLKQDSWQLPQGGIDFGESELDALFRELNEEIGLSFEHISILAKTPKWLRYDFPDYHIKHKQKPVCIGQKQVWFLLRLISNENNIKLNMHTQVEFDDWAWVDYWRPIEDVIDFKKPIYEDMLKALAPVLFNNQHKIPNQYLRPLKCSAIILDK

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.854 kDa

MSKHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.854 kDa

MSKHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.887 kDa

MSEHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLMGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.887 kDa

MSEHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLMGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.887 kDa

MSEHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLMGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.854 kDa

MSKHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.855 kDa

MSEHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.855 kDa

MSEHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

178 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.854 kDa

MSKHKGPTGAMVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEDPAQAALRELYEETGMTSVSLLEEASDWINYDLPPHLVGLALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDCWEWKPMADLPNLIVPFKRKVYEQVVATFRHLAA

rppH

RNA pyrophosphohydrolase

177 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.874 kDa

MIDDDGYRPNVGIVICNRQGQVLWARRYGQNSWQFPQGGINAGETAEQAMYRELFEEVGLGRKDVKILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLQCSEAEINMQRSNTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFSSVVMSLQESVAQGGRSAPGYRRKRG

rppH

RNA pyrophosphohydrolase

177 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.036 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLQRKDVRILATTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSNDADINMQTSSTPEFDGWRWVSFWYPVRQVVSFKRDVYRRVMKEFASVVMPLQESAPPQRNPSPAWRRKRG

rppH

RNA pyrophosphohydrolase

177 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.951 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESPEQAMYRELFEEVGLRKKDVRVLASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMCNESDINMQSSGTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFISPVILLQESVAARVATPPSPRRKRG

rppH

RNA pyrophosphohydrolase

177 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.912 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESAEQAMYRELFEEVGLRKKDVRVLASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMCNESDINMQSSGTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFINPVILLQESVAARVATPSGPRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Master regulator of 5'-end-dependent mRNA decay (PubMed:18202662). Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage (PubMed:18202662). Preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products (PubMed:11479323). Also able to hydrolyze diadenosine hexa- and tetra-phosphate (PubMed:11479323). Has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose (PubMed:11479323). In an RNase PH (rph) wild-type strain background, RppH is not required for maturation of tRNAs; however, strains with the truncated rph allele (for example K12 W1485 and its derivatives MG1655 and W3110) require RppH for maturation of certain monocistronic tRNAs with short (<5 nucleotides) leader sequences (PubMed:28808133). In the meningitis causing strain E.coli K1, has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro (PubMed:10760174).

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.869 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESPEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSNDSEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVIAFQEAPPKPQSAPAWRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.112 kDa

MARYEDLPYRTCVGMMLLNAEGLVFIGRRSGGIEHVDDSHVWQMPQGGVDPGEDTWAAAKRELYEETSVQSVEKLGEISDWLIYDIPRTVAGRAWKGRYRGQRQKWYAVRFTGLDSEIDVTTPGGGHKAEFISWRWEPMQNLPNLIVPFKRPVYERVVKEFSALGFPEPKASVGHR

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.853 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNTPKPQNSPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.81 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNTPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.709 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLIGNDADINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVTMSLAESAPKPQSAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.736 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLIGNDADINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVTMSLAESAPKPQNAPAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.806 kDa

MLDRDGYRPNVGIIICNTRNQVFWGKRVREHSWQFPQGGIKPGESPEAAMYRELMEEVGLSPHHVKIIGRTRDWLRYDVPTHWVRREWRGSYRGQKQIWFLLRLTGRDSDVCLRATHHPEFDGWRWSDYWSPIEHVIDFKRNVYEMALTELSRYLRGLESRQASDAGAVQPDGAPL

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.825 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNTSAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.817 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEIHMPTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNTSAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.795 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.825 kDa

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNTSAYRRKRG

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.15 kDa

MIDDDGYRPNVGIVICNRQGQVLWARRYGQHSWQFPQGGINPGESPEQAMYRELYEEVGLGRKDVRILASTRNWLRYKLPKRLVRWDTRPVCIGQKQRWFLLQLLCNEEDINVQHSNTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMPMQESVSLPRSSYSYRRKRS

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.167 kDa

MIDDDGYRPNVGIVICNRQGQVLWARRYGQHSWQFPQGGINPGESPEQAMYRELFEEVGLSRKDVKILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLTSNDKDINVQQSKTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAPVVMPLQEQVSMSRPSYGYRRKRY

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.253 kDa

MLDREGYRPNVGIILVNTRNEVFWGKRIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEHVKILGRTRGWLRYDVPKHWIKREWRNTYRGQKQIWFLLRLVGRDSDVCLRASTHPEFDAWRWSDYWVPLEAVIEFKRQVYQQALFELSKTLFRTRPCDPPEAYKALAEVREP

rppH

RNA pyrophosphohydrolase

176 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.918 kDa

MIDSDGFRPNVGIILANHRGEVLWARRIGQDSWQFPQGGIKHNETPEDALYRELGEEIGLCASDVEIISCTRGWLRYRLPRRMVRHNSHPVCVGQKQKWFLLRMLSPDAHVRVDGTDSPEFDGWQWVSYWYPLGQVVSFKREVYRRALRELAPRLFHNMEQWHRAENPRRMKEHQK

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.894 kDa

MIDDDGYRPNVGIVICNRQGQVLWARRYGQHSWQFPQGGINPGETAEQAMYRELFEEVGLSKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMCNDADINMQRSSTPEFDGWRWVSFWYPVRQVVSFKRDVYRRVMKEFAVTVMPMQEQAAQRQTPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.886 kDa

MTRYDDLPYRTCVGMMLLNAEGLVFIGRRLGGIEHVDETHVWQMPQGGVDPGEDPWTAAKRELYEETSVRSVEKLGEIADWLIYDIPRTVAGRSWKGRYRGQRQKWYAVRFTGDDSEIDVVSPGGGHKAEFISWRWEPMQNLPDLIVPFKRPVYERVVKEFAALAKDAAKVSGGG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.853 kDa

MIDDDGYRPNVGIVICNRQGQVLWARRFGQHSWQFPQGGINPGETAEQAMYRELFEEVGLNRKDVRILAATRNWLRYKLPKRLVRWDTKPVCIGQKQKWYLLQLMCNDADINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMPLQESTTQRNTPGYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.709 kDa

MVIDRAGYRLNVGIILVNDSDRVFWGRRSGHDAWQFPQGGLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLVIGQKQKWYLLKLVTSEQKVRLDLSDSPEFDSWRWVDFHEPEQQVIFFKRQVYIQALKELEPLLKKERRTPYGLKRKRGNQRA

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.709 kDa

MVIDRAGYRLNVGIILVNDSDRVFWGRRSGHDAWQFPQGGLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLVIGQKQKWYLLKLVTSEQKVRLDLSDSPEFDSWRWVDFHEPEQQVIFFKRQVYIQALKELEPLLKKERRTPYGLKRKRGNQRA

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.577 kDa

MIDDDGYRPNVGIVICNLDGQVLWARRYGQHSWQFPQGGINAGETAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLLCPDADINMQRGGIPEFDGWRWVSFWYPVRQVVSFKRDVYRRVMKEFSGVVMPLQETAAQRSASAHRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.738 kDa

MIDGDGFRPNVGIVICNRDGQVLWAKRYGQHSWQFPQGGVDDGETPEQAMYRELYEEIGLKPEDVTIMATSRNWLKYRLPKRLVRWDSSPVCIGQKQKWFLLQLDPGRESRIQFGCHGHPEFDDWRWVSFWYPVRQVVSFKREVYRRVMKEFAPLAMPVPAVQVNKKDGRRNRPR

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.757 kDa

MIDGDGFRPNVGIVICNRDGQVLWAKRYGQHSWQFPQGGVDDGETPEQAMYRELYEEIGLKPEDVTIMATSRNWLKYRLPKRLVRWDSSPVCIGQKQKWFLLQLDPGRESRIQFGCHGHPEFDDWRWVSFWYPVRQVVSFKREVYRRVMTEFAPLAMPVPVVQVNRKDGRRNRSR

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.069 kDa

MLDREGYRPNVGIILVNARNEVFWGKRIREHSWQFPQGGIKHGESPEQAMYRELYEEVGLRPEHVKILGRTRGWLRYDVPKHWIRREWRNTYRGQKQIWYLLRLVGRDTDVCLRASTHPEFDAWRWSEYWVPLEAVIEFKRQVYQQALTELSRLLFRSKPAELPEGYRQGTASQA

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.709 kDa

MVIDRAGYRLNVGIILVNDSDRVFWGRRSGHDAWQFPQGGLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLVIGQKQKWYLLKLVTSEQKVRLDLSDSPEFDSWRWVDFHEPEQQVIFFKRQVYIQALKELEPLLKKERRTPYGLKRKRGNQRA

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.709 kDa

MVIDRAGYRLNVGIILVNDSDRVFWGRRSGHDAWQFPQGGLAPGETAMQAMYRELHEEVGLDKGDVEILGSTRRWLKYRLPKQYLRHGSEPLVIGQKQKWYLLKLVTSEQKVRLDLSDSPEFDSWRWVDFHEPEQQVIFFKRQVYIQALKELEPLLKKERRTPYGLKRKRGNQRA

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.877 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEADINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAPTVMPVQEAAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

175 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.893 kDa

MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGETPEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQLMCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAPPRVPPAYRRKRG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.574 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTLEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.574 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTLEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.574 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTLEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.574 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTLEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.61 kDa

MIDSDGFRANVGIIICNRFGQVMWARRFGQHSWQFPQGGVDEGESAEQAMYRELYEEVGLRPEHVQVLTSTRSWLRYRLPKRLIRQDSKPLCIGQKQKWFLLQLKSQESAIDLAASGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAPTALPFQAQENTQGGRRRGRRR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.538 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLRPEHVTVLTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTQEIPKKRVRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.546 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAATALSFQTQEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.609 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLRPEHVTILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTQEIPRKRVRQRTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.674 kDa

MLDRDGYRPNVGIILTNAKNEVFWGKRVREHSWQFPQGGIKPGESPEAAMYRELLEEVGLLPQHVKILGRTRDWLRYEVPTNWVRREWRGSYKGQKQIWFLLRLVGRDSDVCLRATNHPEFDGWRWNDYWAPVDAVIEFKRDVYERALSELARFMRGVESHHAYLARTSTQSEQ

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.946 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDEGETPEQAMFRELYEEVGLTKKDVKIIATSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESRINMQRGKSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKTKGKRKKQQRRG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.623 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVTILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTQEIPRKRVRQRTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.623 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGETAEEAMYRELYEEVGLRPEHVTILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTALSFQTQEIPRKRVRQRTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.546 kDa

MIDSDGFRANVGIIICNRYGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLRPEHVHILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLKSQDSAINLSSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAATALSFQTQEIPRKRGRQKTTG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.685 kDa

MIDGDGFRPNVGIVICNRNGQVLWARRYGQHSWQFPQGGVDDGETPEQAMFRELYEEIGLKQDDVTILATSRNWLKYRLPKRLIRWESKPVCIGQKQKWFLLRLDAAKEACIQFGCHGQPEFDDWRWVSYWYPVRQVVSFKREVYRRVMKEFAAIAMPYLPPVAKKEPRRKGYR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.701 kDa

MSKHKGPVDPESLPYRPCVGLMVLNKAGLVWAGRRIVIPGDEMDGATQLWQMPQGGIDKGEEPLEAAIRELYEETGMKSVSLLEEASDWINYDLPPHLVGQALKGKYRGQTQKWFAYRFEGDESEIAINPPPGGHTAEFDRWEWKPMVKLPELIVPFKRKVYEEVVAAFRHLVA

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.867 kDa

MIDGDGYRPNVGIVICNSHGQVFWARRYGQHSWQFPQGGIDEGETPEQAMYRELYEEVGLTKKDVRILASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLSLECDESRVNMQRGSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRALKEFAAIAMPFKERKERKLKRYKSKRG

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.45 kDa

MIDAEGFRANVGIVICNSLGQVFWARRYGQHSWQFPQGGIDEGETAEQTMYRELYEEVGLKPEHVKILAVTKNWLRYKLPKRLIRQGSAPVCIGQKQKWFLLQLTCKEQDVDLLQSGHPEFDDWRWVSFWYPVRNVVSFKREVYRRAMKEFAPTAMALSSKPAQGQRSKRRRKN

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.854 kDa

MIDADGYRPNVGMIICNEQNQVLWAKRRGENAWQFPQGGIDYAETPEQAMFRELEEEVGTAKVCIIGRTRGWLRYEVPCARHRVSRRRYRGQKQIWFLLRFEGEEAEINLRTRQPEFEDWRWVDYWMPVNEIISFKRRVYWQALQELAPLINMNPPPMTDPCRSENRHPVVGNR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.044 kDa

MLDREGYRPNVGIILINERNEVFWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLPQHVKIVGRTRDWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFDGWRWHQYWAPVDEVIDFKRDVYLEALKELSSRFLRGMESYEDFAARQPSGNR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.986 kDa

MLDREGYRPNVGIILINERNEVFWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLPQHVKIVGRTRDWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFDGWRWHQYWAPVDEVIEFKRDVYLGALKELSSRFLRGMESYEDFAARQPSGNR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.034 kDa

MLDREGYRPNVGIILINERNEVFWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLPQHVKIIGRTRDWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFDGWRWHQYWAPVDEVIDFKRDVYLGALKELSSRFLRGMESYEDFAARQSSDNR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

21.019 kDa

MLDREGYRPNVGIILINNRNEVFWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLPQHVKIIGRTRDWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFDGWRWHQYWAPVDEVIDFKRDVYLGALKELSSRFLRGMESYEDFAARQSSDNR

rppH

RNA pyrophosphohydrolase

174 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.952 kDa

MLDREGYRPNVGIILTNNRDEVFWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLSQHVKIVGRTRDWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFDGWRWHQYWAPVDEVIDFKRDVYLGALKELSSRFLRGMESYEDFAARQLSGNR

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.499 kDa

MIDSDGFRANVGIIICNRFGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLKPEHVQILTSTRSWLRYRLPKRLIRQDSKPVCIGQKQKWFLLQLKSAENAIDLNASGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAATTLPLQVKESNNRRRGMRRS

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.514 kDa

MIDSDGFRANVGIIICNRFGQVMWARRFGQHSWQFPQGGVDDGESAEEAMYRELYEEVGLKPEHVQILTSTRSWLRYRLPKRLIRQDSKPVCIGQKQKWFLLQLKSAETAIDLNASGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAVTTLPLQVKESNNRRRGMRRS

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.532 kDa

MIDSDGFRANVGIIICNRSGQVMWARRFGQHSWQFPQGGVDEGESAEEAMYRELYEEVGLRPEHVQILASTRSWLRYRLPKRLIRQDSKPVCIGQKQKWFLLQLKSSENAIDLNACGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAPTTLPLQVKESNHKRRGMRRN

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.556 kDa

MIDADGFRANVGIILANTQGQVLWAKRIGHNAWQFPQGGIDRGETPMDAMYRELWEEVGLHPRHVDLLAVTQDWLRYRLPKRYVRHGQYPLCIGQKQKWFLLRLDEPNTQHIRFDEGKAEFDNWQWVSYWYPLGQVIHFKRGVYRRALQELVPELPLQQGLIIPEQNNHLLQF

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.565 kDa

MIDADGFRANVGIILANTQGQVLWAKRIGHNAWQFPQGGIDRGETPMDAMYRELWEEVGLHPRHVDLLAVTQDWLRYRLPKRYVRHGQYPLCIGQKQKWFLLRLDEPNTQHIRFDEGKPEFDNWQWVSYWYPLGQVIHFKRSVYRRALQELVPELPLQQGLIIPEQNNHLLVE

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.564 kDa

MIDADGFRANVGIILANTQGQVLWAKRVGHDSWQFPQGGIDEGETPLDAMYRELWEEVGLYPRHVQLLAATDNWLRYRLPKRYIRHGQHPLCIGQKQKWFLLKLDEPNTEHIRFDTAKPEFDHWEWVSYWYPLGQVVHFKRGVYRRALRELARELPLKKELILPETKNHLLQV

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.767 kDa

MPKTKKVDRETLPYRPCVGLMILNGEGLVWVGHRIAEPDSEFAGTTQLWQMPQGGIDKGEEPLQAAERELYEETGMRSVSLLAEAPDWINYDLPDHLVGIAFKGRYRGQMQKWFAFRFHGDGSEIQINPPPGGHTAEFDKWSWRPMQDLPDLIVPFKRKVYEEVVAAFSHLAR

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.69 kDa

MIDSDGFRANVGIIICNRFGQVMWARRFGQHSWQYPQGGVDDGETPEEAMYRELYEEVGLRPEHVQILTSTRSWLRYRLPKRLIRQDSKPVCIGQKQKWFLLQLKSSESAINLNACGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAPTALPFQSREHHSNNRRGRRR

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.617 kDa

MIDCDGYRPNVGIILSNQERRLFWAKRIGQQAWQFPQGGIRRDESPLDAMYRELAEETGLGPEHVEVIGKTRDWLRYRLPKHLIRRHSNPVCIGQKQIWFMLRLVGDETCVRLDSVQPAEFDSWRWVDYWRPMREVVFFKRHVYRRALRELAPLLFPEGMPGQQRQPRTRSGA

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.329 kDa

MDTIVDFKALPYRKCVGILVFNYEGKVWVGRRLMTVSHANVDMSKLWQLPQGGINQGEKPIDAARRELYEETGIQSVKLIKEAQDWFEYDFPQELMGHVLNNKYRGQTQKWFSFQFTGEISEITINPPPDGNKAEFDQWKWVDLEELPSIVVSFKKHVYTQVVKEFRNSFKYL

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.343 kDa

MDAVVNLTTLPYRRSVGILVFNHEGKVWVGRRLMVCIHEDTKIYHRWQLPQGGIDENEEPLDAARRELYEETGIRSIELIKEAKYWFHYDFPQEIVGSVLGSKYRGQIQKWFAFQFTGELSEIKINPPPDGHKAEFDQWKWVDLETLPSIVISFKKHVYMKIVNEFRGSFKGL

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.336 kDa

MDTDINLKNLPYRRCVGVVVFNHEGKVWVGRRLTKYAHADTEMSHRWQLPQGGIDEGEEPLDAACRELYEETGIRSIKLIKEARDWFYYDFPQKLVGCTLKNKYRGQIQKWFAFQFTGKLSEIATNPPPDDNKAEFDQWKWVDLEALPSIVISFKKHVYRKVVSEFRGSFRCL

rppH

RNA pyrophosphohydrolase

173 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.15 kDa

MDADVNLKTLPYRKCVGIVVFNHEGKVWVGRRLMTLAHADIDRSHRWQLPQGGIDEDEKPLDAAYRELYEETGIRSVKLIKEAQNWFYYDFPQELVACTLSNKYCGQMQKWFAFQFTGELSEIVINPPPDGNKAEFDQWKWIDLESLPSIAVSFKKHVYMKVVSEFRGSLRSL

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.447 kDa

MIDSDGFRANVGIIICNQYGQVMWARRFGQHSWQFPQGGLDDGESAEEAMYRELYEEVGLRPEQVKILTSTRSWLRYRLPKRLVRQDSKPVCIGQKQKWFLLQLNGNDNNINLNSSGHPEFDDWRWVNYWYPVRQVVSFKRDVYRKVMKEFAPTTLAFQVNDTGRKRNRPRN

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.49 kDa

MIDSDGFRANVGIIICNKFGQVMWARRFGQHSWQFPQGGLDDGESVEEAMYRELYEEVGLRPEHVQILTSTRSWLRYRLPKRLVRQESKPVCIGQKQKWFLLQLKGHDNTINLNSSGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFASTTLALQTREFSKKRSKQRS

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.88 kDa

MIDAEGFRANVGIVICNNQGQVFWARRYGQHSWQFPQGGVDDGETPEQTMYRELHEEVGLRPEDVEIVASSKHWLRYKLPKRLIRRDSSPVCIGQKQKWFLLKLRCKDEDVNLLKTHHPEFDDWRWVSYWYPVRQVVSFKRDVYRRVMKEFAPFAMPFNKREQQKDHWRNKR

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.893 kDa

MTELDHPQHRPNVGVVLFHPDGRVWLGRRHRQAPPYNWQFPQGGVDEGEDLEVAARRELAEETGVTSVELLGRTEGWITYDFPPEVMANPKHARGWRGQKQVWFAYRFVGEESEIDLEADEHIEFDAWRWGRLDETPELIVPFKRGVYEAVVAAFQGFARGDSPVRRREGEN

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.893 kDa

MTELDHPQHRPNVGVVLFHPDGRVWLGRRHRQAPPYNWQFPQGGVDEGEDLEVAARRELAEETGVTSVELLGRTEGWITYDFPPEVMANPKHARGWRGQKQVWFAYRFVGEESEIDLEADEHIEFDAWRWGRLDETPELIVPFKRGVYEAVVAAFQGFARGDSPVRRREGEN

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.761 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDEGETPEQAMFRELYEEVGLTKKDVKIIATSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESRINMQRGKSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKTKGKRKKQRR

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.489 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDDGESPEQAMFRELYEEVGLTKKDVKVIATSRHWLRYKLPKRLVRWDSQPVCIGQKQKWFLLRLECDESKINMQRGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFKERKVKGKRNTHRG

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.589 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDEGETPEQAMYRELYEEVGLTKKDVKIVATSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLDCDESHINMQRGSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFKERKTKGKRKLRRG

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.529 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDDGETPEQAMFRELYEEVGLTHKDVKIIASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESKINMQKGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKLKGKKVKRRG

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.529 kDa

MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDDGETPEQAMFRELYEEVGLTHKDVKIIASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESKINMQKGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKLKGKKVKRRG

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.623 kDa

MIDSDGFRANVGIIICNRFGQVMWARRFGQHSWQFPQGGVDEGETPEEAMFRELYEEVGLRPEHVQILTSTRSWLRYRLPKRLIRQDSKPVCIGQKQKWFLLQLKSNESAIDLNACGHPEFDDWRWVSYWYPVRQVVSFKRDVYRKVMKEFAPTALPFQTREHHHSRRGRRR

rppH

RNA pyrophosphohydrolase

172 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.877 kDa

MIDRDGYRPNVGIILCNARNQVFWGKRIREHSWQFPQGGIKYGESPEQAMYRELMEEVGLRPEHVKILGRTRDWLRYDVPTNWIKREWRGSYRGQKQIWFLLRLIGRDSDVSLRASTHPEFDAWRWSDYWVAMDSVIEFKRDVYRMALKELSMHLTEHRRPRVAERVDQLVR

rppH

RNA pyrophosphohydrolase

171 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.487 kDa

MIDAEGYRANVGIVIINDMGQVFWARRYGQHSWQYPQGGVDEGETAEQTMYRELHEEVGLKPEHVKIVASTKHWLKYKLPKRYIRHDSKPVCIGQKQKWFLLKLTAAESSVDLLHSSHPEFDDWRWVSYWYPVRQVVSFKRDVYRMVMKEFANFALPLTYERRPDRRKRRA

rppH

RNA pyrophosphohydrolase

171 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.457 kDa

MIDTDGFRPNVGIILADGSGRVLWARRVGGQDAWQFPQGGIKESESAEQALYRELQEEVGLKAEDVEILAVTQGWLRYRLPQKLVRQKEPRCVGQKQKWFLLKMLAEDSAVDLIGGGPPEFDEWRWVSYWYPLSKVVSFKREVYRRALKELVAPHNSLLSGLPLVDGESLC

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.847 kDa

MIDADGFRPNVGIILTNHQGQLLWARRVGGQDAWQFPQGGINAHESPEQALYRELHEEVGLYPQDVEILACTRGWLRYRLPHRLVRHNSLPLCVGQKQKWFLLRLLSDDARVCLENGGRAEFDDWRWVSYWYPLGKVVAFKRDVYRRALRELSLAHAQLENSNRKELSRG

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.126 kDa

MTDPMTLPYRPNVGIALFNRDGKLFIARRTDLPGDVWQCPQGGIDEGETPQVAALREMGEEIGTQNARILAERSGWLSYDLPSDLIGKALGGRFRGQTQKWFVMGYEGQDSDIRLDLQDPPEFDAWEWVDPQAVLNRNLGFKKALYAELIPELAALFQAAARDWVRTSRA

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.664 kDa

MIDADGFRPNVGIILTDDQGRLLWARRVGGQDAWQFPQGGIKHNESPENALYRELEEEVGLCKADVEVLGVTQGWLRYRLPRRLVRDKEPKCVGQKQKWYLLRLVSNDSAIRLDASSPAEFDTWNWVSYWYPLGKVVAFKRDVYRRALKELSPVYNQYFLSTLGEGRALC

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.583 kDa

MIDAEGFRANVGIVICNGHGQVFWARRINQQSWQFPQGGIHEGETPEQAMYRELYEEVGLKPEQVEILYTSRQWLRYRLPKRLIRREQRPMCVGQKQKWFLLRLKCREEDVDVLHSGHPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFATQAMPFRASGGRQHRRKR

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.264 kDa

MTIKAEDLPYRPCAGIMVLNAQGLVWAGRRIKEGNSEYDGSPQLWQMPQGGIDDGERPLTAAIRELYEETGMKTVTLLAEASDWIHYDLPPELIGIGLRGKYRGQAQRWFAFRFEGDESEIQIDPPPTGHSAEFDAWDWKPMESLPELIVPFKRAVYEKVVAEFQHLSGK

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.377 kDa

MIDGDGFRPNVGIVICNSHGQVFWAKRYGQHSWQFPQGGIDDGETPEQAMYRELYEEVGLTKNDVRILASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESKVNMQRDRSPEFDGWRWVSYWYPVRQVVSFKRDVYRRALKEFAVIAMPFKERKFKRKGKKG

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.377 kDa

MIDGDGFRPNVGIVICNSHGQVFWAKRYGQHSWQFPQGGIDDGETPEQAMYRELYEEVGLTKNDVRILASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESKVNMQRDRSPEFDGWRWVSYWYPVRQVVSFKRDVYRRALKEFAVIAMPFKERKFKRKGKKG

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.348 kDa

MIDGDGFRPNVGIVICNSHGQVFWAKRYGQHSWQFPQGGIDDGETPEQAMYRELYEEVGLTKNDVRILASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESKVNMQRDRSPEFDGWRWVSYWYPVRQVVSFKRDVYRRALKEFAAIAMPFKERKFKRKGKKG

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage (By similarity). Catalyzes the hydrolysis of diadenosine tetra-, penta-, or hexa-phosphate with the departure of ATP as leaving group. Preferred substrate is Ap4A. Also acts on diguanosine tetra- and penta-phosphate at a lesser extent. Required with IalB for erythrocytes invasion.

Belongs to the Nudix hydrolase family. RppH subfamily.

20.081 kDa

MDTMVDFKTLPYRKGVGIVVFNREGQVWIGRRLITSSHTYAEVSKLWQFPQGGIDEGEEPLDAARRELYEETGMRSVNLIKEVQDWFCYDFPQELIGHVLNNQYRGQMQKWFAFQFIGETSEIVINSPENSNKAEFDQWKWINLEVLPSIVVSFKRHVYMKVVHEFRNII

rppH

RNA pyrophosphohydrolase

170 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.584 kDa

MTRYDDLPYRTCVGMMLINERGLVFVGRRAGVEQVDDSYVWQMPQGGVDPGEDTWLAAKRELYEETSVRSIEKLAEIPDWLTYDIPRVVAGRAWKGRYRGQRQKWYAVRFIGEDNEINIANPGDGHKPEFTAWRWEPMQNLTGLIIPFKRPVYERVVKEFASLAGAQAGT

rppH

RNA pyrophosphohydrolase

168 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.281 kDa

MARYEDLPYRTCVGVMLINREGLVFIGRRAGGIEHVDDTHVWQMPQGGVDPGEDTWKAAKRELYEETSVNSVEKLAEVPDWLIYDIPRTVAGRAWKGRYRGQRQKWFAARFTGADSEINVVHPGGGHKAEFTSWRWEPMHNLPELIVPFKRPVYERVVKEFSQLAAAV

rppH

RNA pyrophosphohydrolase

168 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.28 kDa

MTRYEDLPYRTCVGIALINSEGLVFIGRRAGGIEHVDDAHVWQMPQGGVDPGEDAWEAAKRELYEETSVRSVEKLAEIDDWLTYDIPRTVAGRAWKGRYRGQRQKWFALRFTGTDTEIDVERPGGGVHKAEFISWRWEPMQNLPTLIVPFKRPVYERVVKEFAALAGK

rppH

RNA pyrophosphohydrolase

168 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.269 kDa

MTRYEDLPYRTCVGIALINSEGLVFIGRRAGGIEHVDDTHVWQMPQGGVDPGEDAWEAAKRELYEETSVRSVEKLAEIDDWLTYDIPRTVAGRAWKGRYRGQRQKWFALRFTGKDSEIDVEHPGGGHHKAEFITWRWEPLQNLPTLIVPFKRPVYERVAKEFATLAGG

rppH

RNA pyrophosphohydrolase

168 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.313 kDa

MTRLEDLPYRPCVGLAIFNRAGQVFLGQRLSGPEHVDATHSWQMPQGGIDKGEEPYEAALRELYEETSIRSVVKLGEVEDWLSYDLPGRVAGEAWKGKYRGQTQKWFALRFTGDEGEIDILKPGGGAHKAEFCNWRWDALDRAAELVIPFKRQVYERVAREFRRFAHD

rppH

RNA pyrophosphohydrolase

167 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.943 kDa

MTAEDLPYRPCVGVMVLNRQGLVWAGHRLAVGNSEYDGSPQLWQMPQGGIDEGEDPLEAACRELYEETGIRSVSLLAEAPDWIHYDLPSHLIGIGLKGKYRGQRQRWYAFRFEGDESEIAINPPPGGHEPEFDAWEWKPMHELPGSIVPFKRRAYEEVVAAFSHLVR

rppH

RNA pyrophosphohydrolase

167 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.39 kDa

MARYEDLPYRTCVGMMLINRAGLVFIGRRAGGIEHVDDTHVWQMPQGGVDPGEDTWEAAKRELYEETNVRSVEKIAEVPDWLIYDIPRTVAGRAWKGRYRGQRQKWFAIRFTGQDSEIDIIAPPGHKSEFTSWRWEPMLNLPDLIVPFKRPVYERVVKEFSQLAIAV

rppH

RNA pyrophosphohydrolase

167 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.234 kDa

MARYEDLPYRTCVGMMLINREGLVFIGRRAGGIEHVDDTHVWQMPQGGVDPGEDTWEAAKRELYEETNVRSVEKIGEVPDWLIYDIPRTVAGRAWKGRYRGQRQKWFAVRFTGADSEIDVGAPGGHKPEFTGWRWEPMQNLPDLIVPFKRPVYERVVKEFSQLAVAV

rppH

RNA pyrophosphohydrolase

167 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.818 kDa

MTDAADLPYRRNVGAMLFNAQGRILIGRRTDQPGAGGPLDGGVWQCPQGGIDADEDPEEAVLRELREEIGTDRAVIMGARPDWLTYDLPAALIGRALGGRYRGQTQKWFALRFTGQDSDIRLDDQQPPEFDAWQWIDLPSLPERNVGFKRDIYRTLVRDFARFSQPA

rppH

RNA pyrophosphohydrolase

167 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.191 kDa

MARYEDLPYRTCVGVMLINAKGLVFIGRRAGGIEHIDDTHVWQMPQGGVDPGEDTWAAAKRELYEETSVRSVERLGEVPDWLIYDIPRTVAGRAWKGRYRGQRQKWFAVRFTGKDSEINVENPGGGHKAEFVSWRWEPMKNLPGLIIPFKRPVYERVVKEFSALAEE

rppH

RNA pyrophosphohydrolase

166 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.564 kDa

MIDSEGFRPNVGIILANDNGQVLWAKRIGHNAWQFPQGGIHFGETPEQALYRELREEVGLLPEHVQIIAQTKGWLRYRLPHRYIRPDSDPVCIGQKQKWFLLKLTASTRHIQLNLSDPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMMELCMLLPQQQTFEKSSL

rppH

RNA pyrophosphohydrolase

166 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.297 kDa

MARYEDLPYRSCVGMMLLNPKGLVFIGRRVGGTELIDPAHVWQMPQGGIDPGEDYWEAAQRELLEETNARSIEKLAEATDWFTYDIPRMIAGRSWKGRYRGQRQKWFAIRFTGDDSEINVASPAGHKAEFVDWRWEPMQNLPNLVVPFKRPVYERVVKEFSRFAGE

rppH

RNA pyrophosphohydrolase

165 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.406 kDa

MTPQPPLSAAGLPYRQGVGIMLINARGQVFVARRLDSPEAWQMPQGGIDAGEDPETAAWREMEEEIGTRNALLLGETAGWLGYDLPEELRGRLWGGRFQGQRQKWFAFRFTGQDADINLATAHPEFDAWRWVDVDTLVALIVPFKRPVYEQVVAELAGFAVPQPA

rppH

RNA pyrophosphohydrolase

165 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.492 kDa

MIDADGYRPNVGIIIVNKEGKLFWGKRLYQDAWQFPQGGVRENETPQQAVFRELKEEVGLEPSDVRVLGRTKDWLTYDLPKHLIRHYSQPVCIGQKQIWFLLGMLSDDEKINLNTHETPEFEGWSWVDYWVPVQNVVEFKQSVYHQALTELETHLHKFWTKEHVG

rppH

RNA pyrophosphohydrolase

164 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.705 kDa

MASGSADHEDLRYRQCAGVMLANREGLVFAAQRIDSKNLGAWQMPQGGIDPGETQQEAAMRELEEETGVSADLADVIARMPYPVRYDLPEELQGKLWGGRYRGQEQHWFLARFTGTDADIDIAAHNPPEFSEWKWVEPDELPRLIVPFKREVYRAVVKEFRSLI

rppH

RNA pyrophosphohydrolase

164 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.354 kDa

MTGATALPYRSNVGAALFSRAGKILVARRADLGPDAAYQWQLPQGGIDGDEDPAAAVLRELDEEIGTTAVELLGEIPEWLSYDFPPDVVAKFGARHRGQRQRWFALRFLGTDDMIRLDAHAHPEFDEWRWTELSSIPALAVPFKRPIYERLARDFARFAKTDGA

rppH

RNA pyrophosphohydrolase

163 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.576 kDa

MIDNDGYRLNVGIVICNKKGQVLWAKRYGQYSWQFPQGGIHLTESPEEAMYRELFEELGLNKKDVRILTSTHYWLRYKLPKHLVRWNTDPVCIGQKQRWFLLELTCDDSNINVECTKAPEFDGWCWVSFWYPVRQVVSFKRDVYRQVMKEFFSFVSLIQKHLI

rppH

RNA pyrophosphohydrolase

163 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.176 kDa

MSADLLGPSGLPYRPCAGVVLINPVGLVFAGQRIDNPGPAWQMPQGGIDRGESPREAALRELVEETGVTPDLVDVLAETPGWVTYDLPPELLGKVWKGRYGGQKQKWFAMRFLGEDSAVRIATEHPEFERWQWMRAADLIDGIVPFKRDVYARVLSDFREILA

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.473 kDa

MERTIDPGTLPYRPCVGIVLINREGLIFAGQRIDSPVPAWQMPQGGIDEGEKPREAALRELWEETGIPAERVEFVAKAPDWVTYDLPPELLGRVWGGKYRGQRQKWFLYRYLGTDDEVGIGTDHAEFSCWRWIGAEEMVAAIVPFKRAVYEEVVATFRPHLA

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.543 kDa

MERTIDPLTLPYRPCVGIVLINREGLIFAGQRIDSPVPAWQMPQGGIDEGEKPREAALRELWEETGIPAERVEFVAKAPDWVTYDLPPELLGRVWGGKYRGQRQKWFLYRYLGTDEEVGIGTDHAEFSCWRWIGAEEMVAAIVPFKRAVYEEVVATFRPHLA

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.641 kDa

MERVIDPEALPYRPCVGIVLINREGLIFAGQRIDSPVPAWQMPQGGIDADEKPRQAALRELQEETGIPEDLVEFVAKAPEWVTYDLPPDLLGRVWGGKYRGQRQKWFLFRYLGTDEQIGIATEHAEFSCWRWIGAEEMVASIVPFKRPVYERVVAMFREHLS

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.543 kDa

MERTIDPLTLPYRPCVGIVLINREGLIFAGQRIDSPVPAWQMPQGGIDEGEKPREAALRELWEETGIPAERVEFVAKAPDWVTYDLPPELLGRVWGGKYRGQRQKWFLYRYLGTDEEVGIGTDHAEFSCWRWIGAEEMVAAIVPFKRAVYEEVVATFRPHLA

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.877 kDa

MVEQKDKYRPCVGIMLFNRQGHAFIGKRFESDSYWQMPQGGVDDGEELEQAALRELLEEVGTNKVKVITKSKDWIYYNLPEEVIPICWNGKYSGQKQRWFLMKFCGEDEDIDINYTGHPEFKEWRWQGIDSLVASAISFKKEVYKTVIEEFSSIIKASTISS

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

19.096 kDa

MISEEKEYRPCVGIMLFNKQGNIFIGKRFDSDSYWQMPQGGVDEGEELEQAALRELLEEVGTDEAEVVAQNKEWIYYNLPEEVIPICWNGRYSGQKQRWFLMKFCGKDKDININYTDHPEFKEWRWQNVDDLVASAIPFKKEVYKKVIEEFSSIIKGSIYDS

rppH

RNA pyrophosphohydrolase

162 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.

18.863 kDa

MVEQKDKYRPCVGIMLFNRQGHAFIGKRFDSDSYWQMPQGGVDDGEELEQAALRELLEEVGTNKVKVITKSKDWIYYNLPEEVIPICWNGKYSGQKQRWFLMKFCGEDEDIDINYTGHPEFKEWRWQGIDSLVASAISFKKEVYKTVIEEFSSIIKASTISS

rppH

RNA pyrophosphohydrolase

161 amino acids

Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.

Belongs to the Nudix hydrolase family. RppH subfamily.