rplF

50S ribosomal protein L6

203 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

21.884 kDa

MSRIGKLAIPVPAGATVTVAGQTIKVKGPKGELELVLPEVITPKFDNNELSVNPRADLIQAANDVIEAETAKGKRPPTFAQSLSQDARTQWGTARARAANMVEGVTKGYSKTLELVGVGYRAQMQGVDLKLALGYSHDVIYKAPQGIKIEAPKPTEIIISGADKQAVGQVAAEIKKFRPPEPYKGKGIRLQGEYVRRKEGKKK

rplF

50S ribosomal protein L6

191 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.63 kDa

MSRIGKLPIAIPPKVEVTLDGRRVVVKGPKGTLDLTLPDSVEVVREDGRLLVTRRGESRRAREQHGLGRTLVANMVTGVTTGFTKPMQIAGVGYRVALTGRKLTINAGFSHPIEIELPAGIDIEVDPKASAIAGTRNQQGFNFVIKGFDKQAVGDLAAKIRDIRPPEPYKGKGIRYTAEKILLKAGKSGKK

rplF

50S ribosomal protein L6

191 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.599 kDa

MSRIGKRPIPIPDKVAVTIDGSTVKVKGPKGELSQVLPPEVVVVQENSSLLVNRRDDSRPARQRHGLSRTLVANMVKGVTEGFRKNMQIVGVGYRLQVTGNKLAITAGYSHPVEIDLPKGISVEVDQKAVPIANSKSQQGFNFGVIGIDKQAVGDVAALIRAVRPLEPYKGKGIRYATETLRLKAGKTGKK

rplF

50S ribosomal protein L6

189 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.804 kDa

MSRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHITLTENENAMLDNPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFIQLPPEVKVETKSERNKNPLILLESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEEIRRKSGKSAGAK

rplF

50S ribosomal protein L6

189 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.804 kDa

MSRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHITLTENENAMLDNPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFIQLPPEVKVETKSERNKNPLILLESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEEIRRKSGKSAGAK

rplF

50S ribosomal protein L6

189 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.806 kDa

MSRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHVTLTENEKEMIDNPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFIQLPAEVKVETKSERNKNPLIILESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEVIRRKSGKSAGAK

rplF

50S ribosomal protein L6

189 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.909 kDa

MSRIGKLPISIPTGVTVTLKDNVVTVKGPKGELSQFVDPSINVAIEDGHVMLTENENAMLDNVKQRHAFHGLYRSLVNNMVIGVSEGYKKELELVGVGYRASNNGNIIDFALGYTHNIFMQLPPEIKVETKSERNKNPLIILESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEEIRRKSGKSAGAK

rplF

50S ribosomal protein L6

189 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.071 kDa

MSRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQDDSRTARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDGVSVAVENSTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRRKVGKAGGKGAKGGKGGKK

rplF

50S ribosomal protein L6

188 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.345 kDa

MSRIGKLAIKLGDKTKAVIAGEQVNFEGPKGKLSVKLPGKVKVEIKDGQMTVQREDDSREARSLHGLTRTILANAAKGVSTGFEKKLDIRGVGFRAEVKGKAIHFSLGFSHPVVFNLPEGVTAEVDKAPRNEDSLPTVGLTLRSSDKEALGATAVNIRSLRPPEPYKGKGIKYAEERIRRKEGKTGTT

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

21.359 kDa

MSRLVKKPIPYPENVKVSYDEKEHKVTVEGPKGKLELNIHPDIKVTLNQQERWIKLDRPSDRSFHKAIHGTMAALIKNMIKGVTEGFTEILEIHGLGYRAQLKGNVLELHLGKSHPDIYPIPPDVKIEVKGNEIHIHGIDKQRVGQVAAEIRSFRKPDPYKGKGIRYKGEQLSSNPERLQVRSKEVR

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.56 kDa

MSRIGKRPIPLPKNVTLTLDGQQVTVKGPKGQLSRVFPPEVNVVQEGEAIVVKRRDDSRPAKERHGLCRTLLANMVEGVSQGFTKKLEIQGVGYRAQLQGKTLVLSMGYSHPVEIVPPEGITLEIEDNQGKKVQQGTIVLVSGIDKELVGNTSARIRAVRPPEPYKGKGIRYMGEFVRRKVGKTGKK

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.768 kDa

MSRIGKKPIPVPRGVEVTIAEGNVVTVKGPKGTLIQRLPPEMIITHENGVITVARLSDQKQHRALHGLTRSLIANMVTGVTEGYQRVLEITGIGYRAVREGKNLILQVGFSHPIRVTPPEGITFEVMERRSANEPQQVIIRGIDKQKVGEEAAKLRALRPPEPYKGYGIKYREERVRRKAGKAGKAR

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.85 kDa

MSRIGKKPIPVPRGVEVTITEENRVTVKGPKGTLSQQFSPEMLITHENGVITVARPSDDKRHRALHGLTRSLIANMVTGVTEGYQRILEITGIGYRAAREGKNLVLQVGFSHPIRVTPPEGITFEVLERRSANEPQQVIIRGIDKQKVGEEAAKLRALRPPEPYKGYGIKYRDERIRRKAGKAGKAR

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.524 kDa

MSRIGKRPITVPKGVQVTIGEQNLVTVKGPKGTLSQQLHPEMIIRQEGDVITVQRPSDGKLHRALHGLTRTLIHNMVVGVTQGWQRALEINGVGYRAQLEGKTLVLNLGFSHPVRIEPPPNISYIVGERKSANDPLALTVVGIDKQQVGEEAARIRSLRPPEPYKGKGIKYAEEKIRRKAGKAGKAK

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.633 kDa

MSRIGKRPITVPKGVQVTIGEQNLVTVKGPKGTLTQKLHPDMIIKQEGDVITVQRPSDEKLHRSLHGLTRTLINNMIVGVTQGWQRALEINGVGYRAQLEGKTLVLNLGFSHPVRIEPPPNISYIVGERKSANDPLSLTVVGIDKQQVGEEAARIRSLRPPEPYKGKGIKYLEEKIRRKAGKAGKAK

rplF

50S ribosomal protein L6

187 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.524 kDa

MSRIGKRPITVPKGVQVTIGEQNLVTVKGPKGTLSQQLHPEMIIRQEGDVITVQRPSDGKLHRALHGLTRTLIHNMVVGVTQGWQRALEINGVGYRAQLEGKTLVLNLGFSHPVRIEPPPNISYIVGERKSANDPLALTVVGIDKQQVGEEAARIRSLRPPEPYKGKGIKYAEEKIRRKAGKAGKAK

rplF

50S ribosomal protein L6

185 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.574 kDa

MSRIGKQPIAVPSGVTVNTQSGVFKVKGPKGELTVPFNPDLTIREDNGQLLVERPSDRQEHRALHGLTRTLVANAVKGVSDGFVINLELRGVGYRAKLNGKALELTIGYSHPVVIDPPAGVTFAVPEPTKIDVSGIDKQLVGQVAANVREVRKPDAYHGKGVRFVGQQIALKAGKAGATGGKGKK

rplF

50S ribosomal protein L6

185 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.636 kDa

MSRIGRQPIAVPNGVTVNAQNGVFTAKGPKGELSVPYNTALNITQENGQLLVTRPSDRQEHRALHGLTRTLVANAVKGVSDGYTINLELRGVGYRARLVGKNLELTIGYSHPVVIEPPAGVTFAVPEPTRIDVMGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGKAGATGGKGKK

rplF

50S ribosomal protein L6

185 amino acids

It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center (By similarity). This protein binds to the 23S rRNA, and is important in its secondary structure.

Belongs to the universal ribosomal protein uL6 family.

19.582 kDa

MSRIGKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGKAGATGGKGKK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.365 kDa

MSRIGKLPIKLPQGVTLRGPEEDIVYVKGPKGELSQYIDPAISVTIENDTVTLHRRTNQKRHKALHGLYRVLINNMIIGVSTGFTKSLELVGVGYKASVQGNALDLDLGYSHKIYFVIPPEIKVQAETTKGKNPLVHLEGIDKQLLGQVAAKIKTLRKVEPYKGKGIRYLGEQIRRKAGKTASK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.515 kDa

MSKLGKKPILIPSGVQINIEGDMISVKGPKGTLSQRLSPYIKVAIEENKLWVQQNEESIVRRSQRKMLRTFQGTYWSLIKNMITGVTEGFEKQLEIVGVGYRAQLQGNKVSLQLGYTHPIVLEPPVGVSVEVPAPNVVVVKGIDKQKVGQFAAEVRSWRKVNVYSGKGVKYRNEVVKLKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.64 kDa

MSRVGNKAIEVPNAVKVDIKDRNFISVEGPKGKLEYQFNHRLTITNENKVITVKRPNDEIFMKKIHGTTRALLSNMVEGVSKGFQKTLKIVGLAYRAQIKDKQLILSLGFSHPVSVAIPDNLEVVVNQNTEIVIKGIDKQLVGEFAAKNVKLRKPEPYKGKGIRYVGQYVRQKAGKSAKKTRKD

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.917 kDa

MSRIGKRPISIPGGVDVNIEGNVVTVKGPKGTLTKEMHSLINIAVEEQQIVVTRPDDQPLSRSLHGLTRTLVANMVEGVTKGFSKSLDMVGVGYRAAKQGNKLVLSVGKSHPVELIPFEGIEVEVPAQNKIIVKGMDKELVGDFAAEIRKERPPEPYKGKGIKYENEVVRRKAGKTGAKKGGKK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.917 kDa

MSRIGKRPISIPGGVDVNIEGNVVTVKGPKGTLTKEMHSLINIAVEEQQIVVTRPDDQPLSRSLHGLTRTLVANMVEGVTKGFSKSLDMVGVGYRAAKQGNKLVLSVGKSHPVELIPFEGIEVEVPAQNKIIVKGMDKELVGDFAAEIRKERPPEPYKGKGIKYENEVVRRKAGKTGAKKGGKK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.77 kDa

MSRIANKPIVIPNGVEVKVEGNVLKVKGPLGELKQDFLPYVKVEINGNEMNVKPNVDYMKRRSDLKKMKMFTGTYWRLFNNMVIGVTKGFKKELEIVGIGYRAQLQGKKLVMNLGYAHPVEMEIPSDVKVEVPSPNKIIVSGIDKQRVGQVAADIRKWREPNVYSGKGIRYVGEVVRLKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.991 kDa

MSRIANKPIVIPNGVEVKVENNVFKVKGPKGELSQEFLPYIKIEVNENEIYVKPNLEFMKRKSDLKKMKMFTGTYWRLFNNMIIGVTQGFRKELEIIGIGYRAQLQGKKLVMNLGYAHPVEMEIPSDVAVEVPSPNRIVVSGIDKQRVGQVAADIRRWREPNVYSGKGIRYVGEVVRLKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.786 kDa

MSRLAKKPIVLPQGVTVEIKDNVVKVKGPKGELSQEFLPYVKIEVEGNEVWVRPNEEQIIRKSDWRKVKMFQGTYWSLIRNMVVGVTEGYKKELEIVGIGYRAQLQGNTLVMNLGYAHPVVYEIPSDVKIEVPAPNRIIVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.731 kDa

MSRLAKKPINIPQGVTVEVNDGTVKVRGPKGELTQDFLPYVKIEIEDGKVWIRPNEAQVRRKSDWRKVKMFQGTYWSLIRNMVIGVTEGYKKELEIVGIGYRAQLQGNTLVMNLGYAHPVVYEIPSDVKVEVPAPNRIVVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.757 kDa

MSRLAKKPIVLPQGVTVEIKDNVVKVKGPKGELSQEFLPYVKIEVEGNEVWVRPNENQIIRKSDWRKIKMFQGTYWSLIRNMVVGVTEGYKKELEIVGIGYRAQLQGNTVVMNLGYAHPVVYEIPSDVKIEVPAPNRIVVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.339 kDa

MSRIGKRPIPIPAGVQVELTPDNVVRVTGPKGQLELRLHPKMIVQRENGVVQVQRPSDERFFKQLHGLYRTLIANMVQGVTEGFRKDLEIHGVGYRAALEGKTLVLTVGYSHPVRIDPPPGISFIVESPTRIGVVGIDKQLVGEVAAQIRRVRPPEPYQGKGIRYAGEVIRRKAGKTGKTKGKK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.757 kDa

MSRLAKKPIVLPQGVTVEIKDNVVKVKGPKGELSQEFLPYVKIEVEGNEVWVRPNENQIIRKSDWRKIKMFQGTYWSLIRNMVVGVTEGYKKELEIVGIGYRAQLQGNTVVMNLGYAHPVVYEIPSDVKIEVPAPNRIVVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.944 kDa

MSRLIKKPIPVPNGVQVEIKENIIKVKGPKGELSQEYLPYVKIEQKEDGIWVTPNEEMVRRQSDRRKLAMFSGTYWALVRNMIIGVTQGYQKELEIKGVGYRAQLQGKKLVLNLGYAHPVEIEPPEGITIEVPNPTSIIVKGIDKYLVGQVAANIRRWREPIVYSGKGIRYKGEYVRTKVGKKV

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.247 kDa

MARIGDNPIPFGDEVTVSVDDHNVVTIEGPKGTLTEQIDPEMTLDIADDHVVVRRPTNQKRHRSLHGLSRSLIVNMVEGVTEGYKKELKIIGVGYRAQMSDETLEIALGYSHPIYFLPPSDVAVSVDSDRGQDDIIIVEGIDKELVGQVAAKIRSLRPPEPYKGKGVRYVDEHVPLKAGKTAAR

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.594 kDa

MSRVGNKAIEVPNAVKVDIKDRNFISVEGPKGKLEYQFNHRLIITNENKVITVKRPNDEIFMKKIHGTTRALLSNMVEGVSKGFQKTLKIVGLAYRAQIKGKQLILSLGFSHPVSVAIPDNLEVVVNQNTEIVIKGIDKQLVGEFAAKNVKLRKPEPYKGKGIRYVGQYVRQKAGKSAKKTRKD

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.644 kDa

MSRIAKKPIVLPTNVQLSITDSEIKVKGPKGELKLNNHPFVSIKVEGNEVWVTPNLEVAKRKADERKFKAMVGTYWRLIRNMVLGVTEGFKKELEIVGVGYRAQLQGNKLIMNLGYAHQVEFDVPADVKVEVPAPNKIIVSGIDKQRVGQVAADIRKWREPNPYSGKGIKYVDEVLKLKEGKKA

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.589 kDa

MSKIGNRTITLDPAKVNLNFQKDHIAVKGPLGQIELKLPPNLPLKFELKDNNLQITRNNELKQSKIFHGTYNALITNAIIGVTQGFEKKLRLVGVGYRANVEGETLNLQLGYSHPIKEKIPKGLTVKVEKNTEITISGISKELVGQFATEVRKWRKPEPYKGKGVLYFDEVIVRKAGKTAEGKK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.974 kDa

MSRIGKLPVTLPEKVELSVSPSNLVTVKGPKGTLTQQVDVDIKVSVEDGKVVVARPTEQKRHKALHGLYRSLISNMVQGVSQGYKVELELVGVGYKATATNNILELSLGYSHGIFLKLPSEISASALTEKGKNPIVTLECIDKQLIGQVSAKIRSLRKIEPYKGKGVRFKGEVVRRKAGKTASK

rplF

50S ribosomal protein L6

184 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.523 kDa

MSKIGNRSIKIDPSKVSLMQTTTLLTIKGPLGENTIKLPKNLPLKFVVENDTIKVTNNNNLKQTKILHGTFNALVNNAVIGVTKGFEKKLILVGVGYRANVEGQFLNLQLGYSHPIKELIPNQLTVKVEKNTEITISGIKKELVGQFATEIRKWRKPEPYKGKGVLYFNEVIVRKQGKTAEGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.68 kDa

MSRLAKKPIPYPENVKVNYVEKEHKIVVEGPKGKLELNVHPDIKVTVNQQERWIKLDRPTDRSFHKAIHGTMAALVKNMIKGVTEGFTEVLEIHGLGYRAQLKGNVLELHLGKSHPDIYPIPPDVKIEVKGNEIHIHGIDKQRVGQVAAEIRSFRKPDPYKGKGIRYKGEQLKLKPGKAVGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.593 kDa

MSRIGKKPVAIPAGVNVTIEGNVVTVKGPKGQLSRELHKDIIVTVEGNTVQVTRPSDDKFHRSLHGLSRTLVANMVDGVSVGFSKSLELVGVGYRAAKQGKKLVLTVGYSHPVEIEPGEGLEVEVPAPTKIIVKGIDKEKVGALAANIRAVREPEPYKGKGIKYETEVIRRKVGKTGGKKGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.283 kDa

MSRIGKLPIHVPAGVTVTIKDNVVTVKGPKGELVQEVNPDINVTLEDGVIHLTRPTDDKNHRALHGLYRSLINNMVVGCSEGYKKELELVGVGYRVSNTGQLLDLSLGYTHNIYLQLPKEVKVETKSERNKNPLIILESADKQLLGQICAKIRSFRMPEPYKGKGIKFVGEEIRRKSGKSAGK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.094 kDa

MSRKARDPIVLPQGVEVSIQNNEILVKGPKGSLKQVLAPEVVIDIKGREVFVHPAPYVVDRPSRMQGLFWALISNMVQGVSVGFEKRLEMIGVGFRASVQGSILDLSIGVSHPTKIPIPADIQVSVEKNTIISVKGINKQLVGEFAANIRAKRKPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.118 kDa

MSRKARDPIVLPQGVEVSIQNNEILVKGPKGSLKQVLAPEVVVDIKDREVFVHAAPHVVDRPSRMQGLFWALISNMVQGVNTGFEKRLEMIGVGFRAAVQGSVLDLSIGVSHPTKMPIPAELQVSVEKNTLISVKGINKQLVGEFAASIRAKRRPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.937 kDa

MSRKARDPIVLPQGVEVSLQNNEIVVKGPKGSLTQTLAPEVVVEIKDKEVFVSPAPNVVDRPSRVQGLFWALISNMVQGVSAGFEKRLEMIGVGFRAAVQGSVLDLSIGVSHPTKIPIPADIQVTVEKNTLISVKGINKQLVGEFAANIRAKRRPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.945 kDa

MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVSPAAHIIDRPGRMQGLYWALIANMVKGVHLGFEKRLEMIGVGFRASVQGSFLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.1 kDa

MSRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITLKDNSIFVHAAPHVVDRPSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQGAFLDLSIGVSHPTKIPIPSTLQVSVEKNTLISVKGLDKQLVGEFAASIRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.839 kDa

MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVAPAAHVVDRPGRMQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.881 kDa

MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVTPAAHVVDRPGRIQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFATCVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.839 kDa

MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVAPAAHVVDRPGRMQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.851 kDa

MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVTPAAHVVDRPGRIQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.146 kDa

MSRIGKLPITVPKGVTVKLEGDNLLTVKGTKGTLSKKFNKDMIIKVEADQIVVQRPSDLKIYKSLHGLTRTLINNMVEGVTNGFQKTLEINGVGYRAQKQGKKLVLTLGYSHPVEMEDPEGIATEVPAPNKIIVKGIDKQVVGEVAAKIREKRLPEPYKGKGIKYETEVIRRKEGKTGGKGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.355 kDa

MSRIGKLPISIPAGVTVSHKDEIVTVKGPKGELSQYVDPRITVVIEGGMIHLERKTDDRIERSLHGLYRSLINNMVQGVSAGFKRELELVGVGYRASNQGQLLELSLGFTHSIFMQLPKEVTVETKSERNKNPLIILESADKQLLGQVCMKIRSFRKPEPYKGKGVKFVGEQIRRKSGKSAGK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.355 kDa

MSRIGKLPISIPAGVTVSHKDEIVTVKGPKGELSQYVDPRITVVIEGGMIHLERKTDDRIERSLHGLYRSLINNMVQGVSAGFKRELELVGVGYRASNQGQLLELSLGFTHSIFMQLPKEVTVETKSERNKNPLIILESADKQLLGQVCMKIRSFRKPEPYKGKGVKFVGEQIRRKSGKSAGK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.443 kDa

MSRVGNRLLSIPSGVNVEVEKSLVKITGKLGTLSVPFDSKKLSVLNKDSMVIVKRANDEKETKMLHGTTNANINNALIGVNSGHTKKLKIVGVGYKAAVNGNKINLNLGYSHPIDLEIPAGLNVTCPQATEVVITGADKAVVGQFAAVIRSKRPPEPYKGKGVAYSNEVIIRKVGKTAEGSKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.651 kDa

MSRIGKKPVKIPAGVEVNIEGNTVTVKGPKGKLTRQFPAEITISREGEELQVSRPSDAKPHRALHGLSRALLQNMVDGVTRGFEKGLELVGVGYRAAKQGNKLVLSVGYSHPVEMVPGEGLEIEVPAPNKVIVKGIDKEAVGALAAKIRDVRPPEPYKGKGIKYEGEYIRRKVGKTGAKGGKK

rplF

50S ribosomal protein L6

183 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.433 kDa

MSRIGNRVITVPSNVSVNQTKELLTVKGPLGQLDLKLKEGSKIKVNVENNEIRLTRGDELKQTKMLHGTYNALIKNALEGVTVGFKKELRLVGVGYRASLKDNVLNLQLGYSHPINLDIPKDLKVTVDKNTEITVSGIDKQKVGEFAIQIRKWRMPEPYKGKGVLYLNEQIIRKAGKTAEGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.914 kDa

MSRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPVNVSVSQEGETLQVTRRDETRTSRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLILNMGYSHQVQIEPPDGIQFAVENNTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRRKAGKTGKGGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.076 kDa

MSRIGRKPIDIPSGVDVKIDGNVITVKGPKGTLTREIHPEMIVKIENNQIIVQRPSDERFHKALHGLTRTLIANMVEGVTKGYEKVLEVVGIGYRAQKQGKKLVLNVGYSHPVEIEEPAGITIEVPDQNRIVVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.98 kDa

MSRIGKKPIDIPSGVEVKIDGNVITVKGPKGSLTKEIHPEMIVKIENNQILVQRPSDERHHKALHGLTRTLIANMVAGVTKGYEKVLEIVGIGYRAQKQGKKLILNVGYSHPVEIEEPAGITIEVPDQNRIVVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.921 kDa

MSRIGRKPIPVPQGVEVKVEGTTVTVKGPKGSLTREFHPDMKITFDGSQILVERPSDEKEHKALHGLTRTLINNMIVGVTNGYQKSLELVGVGYRAAKQGRKLVLTVGYSHPVEMDPPEGIEIEVPAQNQIIVKGIDKELVGNFAATIRAVREPEPYKGKGIKYTDEVIRRKAGKTGGKGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.894 kDa

MSRIGKRPITIPAKVQVAINGTNIVVKGPKGELSRTLRDNVSLSQEGEILHVNRRDETRTSKQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQLQGRNLVLNMGYSHQVQIEPPDGIQFAVEGTTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRRKAGKTGKGGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.886 kDa

MSRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPANVSVSQEGETLQVTRRDETRTSRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIEPPDGIQFVVENNTNVIVSGYDKEIVGNTAAKVRAVRPPEPYKGKGIRYAGEVVRRKAGKTGKGGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.726 kDa

MSRIGKKPIPVPQGVDVKINGNVISVKGPKGQLEQEFHQDMNIKLEEGNLVVERPSDAKDHRALHGLTRTLLNNMVEGVTNGFQRNLELVGVGYRAAKQGNKLVLTIGYSHPVEIEPPAGIEIEVPAATKIAIKGSDKQAVGQLAANIRAVREPEPYKGKGIKYENEIIRRKAGKAGGKGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.705 kDa

MSRIGRQPITVPAGVEVEIDGSTVKVKGPKGQLVKEMHRDMIIKYEDGRLIVERPANDKLHKSLHGLTRTLLNNMVVGVTAGFQKNLELVGVGYRASKQGNKLVLAVGYSHPVEIEPEAGLEIEVPAPTKISIKGVDKEKVGALAAAIRAVRQPEPYKGKGIKYEGEKIRRKVGKAGGKGKK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.808 kDa

MSRIGNIPVLIPNNVFVKKQDNIIYINGPLGKLNQKIIGDINIIINNNNIIVKRKHNDKKNRALHGLYRMLIYNMIKGVYNGFKKKLELIGVGFRAKNNSNILDLNIGYSHNIIIKLPKSITLEVKMEKNKNTQIILKSYDKQLLGIVAAKIRSLRKPEPYKGKGIRYINEYVIKKTGKSAK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.515 kDa

MSRIGKMPIKVPPGVTVDIKGNDVTVKGPKGTLNRTFRPEVTITRDGDYLVVAPVGTDKAARSFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGNNIIFKVGYSHTVTVAPPAGITLSVDGTTKVKVSGINKEEVSQMAAEIRSIRKPDHYMGKGIRYAGEYVRIKPGKAIGKGAK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.471 kDa

MSRIGKMPIKVPLGIKVDINGNDVTVKGPKGTLSRSFRPEVTINREGDYLVVAPVGTDKATRAFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGDKVVFKVGFSHSVTVAPPAGITLSVDGTTKVKVSGINKEDVGQMAAEIRSIRKPDHYMGKGIRYAGEYVRIKPGKAIGKGAK

rplF

50S ribosomal protein L6

182 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.471 kDa

MSRIGKMPIKVPPGIKVDINGNDVTVKGPKGTLSRSFRPEVTINREGDYLVVAPVGTDKATRSFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGDKVVFKVGFSHSVTVAPPAGITLSVDGTTKVKVSGINKEDVGQMAAEIRSIRKPDHYMGKGIRYAGEYVRIKPGKAIGKGAK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.725 kDa

MSRIGKKPVVVPKGVTVTIDGSTVTVKGPKGTLTRTFDPRIKISLIEDQIIVERTSEEKEVRALHGTTRALIQNMVTGVSEGFSVTLKIRGVGYRAELKGKDLQMSLGFSHPVVIQSIEGIQFQVPSADTVVVSGIDKQLVTQVAANIRRYRIPDAYKGKGIWYEGEQRPLKPGKAVGKGK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.839 kDa

MSRIGKLPIMIPAGVEITFGEKNISIKGPKATLVTPKCELLSYEHKEDKIILTCNFDTRESLAQYGLRRTLLANCIEGVTKGFSKTLEVIGVGYRVSVKGNIVELSVGYSHPVHIELPDGITAKAEGQKLTIMGSDKVLVGEMAARIRRIRKPEPYKGKGIKYESEIIRRKAGKSGGKGKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.095 kDa

MSRVAKSSITIPTSVEVIITGNLMSVKGRLGQLNMSIHPCVAIMNTNSKLSFDIITIEKKEQRKAWAQAGTARANTANLIQGVTEGWKKKLTLIGVGYRAKVMGKILDLTLGFSHPINYKFPEGIIVETPSQTEIIIKGMDKQKVGQVASEIRSYRPPEPYKGKGVRYIDEQVIHKETKKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.883 kDa

MSRIGRMPIKIPPDVKITIEGNTVRVEGPKGRLEREIPANTKLVVENGRAVIEKAGEEKPGTAMLGLTRTLVANMVDGVTKGFQRNLELTGVGYRASLQGRKLVMTLGYSHPVEYEPPADIEIEVPAVTRIIIRGADKEKVGRVAAKIRSFRSPEPYKGKGVRYEGEKIRLKAGKAGLKKR

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.637 kDa

MSRIGKRPIALPAKVEVQIEGQQISVKGPKGELSRSLPPLIAVHQEAQTLKVSRVNESRPARQLHGLCRTLVANMVDGVSRGFERRLELVGVGYRASTQGNKLILNVGYSHPVEIPFPPGIQIAVEGNNVIVVSGIDKELVGNTAARIRAVRPPEPYKGKGIRYVGEQVRRKAGKSGKAKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.609 kDa

MSRIGRRPIALPAKVEIQIDGQHIAVKGPKGQLSRSLPPLITVQQNAQMLTVSRLNDSRPARQLHGLCRTLVANMVDGVSKGFERRLELVGVGYRAAIQGSKLVLNVGYSHPVEIPFPPGIQIAVEGNNIIVVSGTDKELVGNTAARIRAVRPPEPYKGKGIRYLGEQVRRKAGKSGKAKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.384 kDa

MSRIGKNPVPVPEKVTVSLDGLTVKVKGPKGELERTLPEGVSVSVSQDNNTIVVSPTSTKRISRERHGLSRTLVANMIEGVSNGYSKALEIVGVGSRAQVKGKTLVVSAGYSHPVEMEAPEGITFKVENNTRVIVSGIDKELVGNEAAKVRAIRPPEPYKGKGIKYEGERILRKAGKSGKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.548 kDa

MSRIGKKPIAIPNNVKVSLDGNVLTIEGPKGKLSMPVHEIVNVKIDNNQITVSKNQESPFAQAMHGTTAALIKNTIEGVSKGYSVTLEVVGLGYKAAMKGQELELNLGYSHPIYYKPPAGIKLEVKENKITVSGIDKQLVGQVAAEIIKFRKPDPYKGKGIRYEGQVLKLKPGKSAGKGKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.006 kDa

MSRVAKSPITIPTGVEVTITSNLMSVKGRFGQLNMSIHPCIVITNTNNKLSFDITITEKKEQKKAWAQAGTARANTANLIQGVTEGWEKKLTLIGVGYRAKVMERVLNLTLGFSHPINYKLPEGITVEAPSQTEIIIKGMDKQKVGQVAAEIRAYHPPEPYKGKGVCYIDEQVVRKEAKKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.734 kDa

MSRIGNKPVAIPSGVTVSIADRNIDVEGPKGKLSFKHRPEVKVAVDSDTNQVIVSRDGDDRPSREFHGLTRAIVANMLVGVKDGYEKKLEIVGVGYLASISGDTLQLRVGYANELHRKIPTDLTVTCPDQTHVVIQGCDKQSVGQFAAEIRSLRKPEPYKGKGIRYQGEQVKIKPGKSATK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.47 kDa

MSRIGNKEIQVPDSVNVQIQDKNFIVVTGPQGKLEYQFNHKIKILLINTIIKVSRPNNELFMKKIHGTTRALLSNMIEGVEKGFVKRLEIVGLDYKVDLQGDNLILHLGFSHSIKITIPKGIDIEIPKKIKGIHIKGIDKQFVGEFASKIAKLRKPEPYKGKGIRFEGQYVIRKAGKSTKK

rplF

50S ribosomal protein L6

181 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.559 kDa

MSRIGKNPIAIPAGVTVEVNNSIVTVKGKLGQLTQNYTNNVTVKVEEGQVIVERAADSKQERAQHGLYRALINNMVAGVSTGFTKELELVGVGYRASNQGQKLDLALGFSHNIVLEIASEVTLETISEKGKNPIVKLTSFDKQLLGQVAAKIRGFRKPEPYKGKGVKFVGEVLRRKAGKSA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.476 kDa

MSRVGKLPVKIPEKVKVSVDGNVVKVEGPKGKMHFPTNPLVSVQVDKGEVKVARQDESHVAKGLHGLTRTLVKNALEGVVKGYEKGLEINGVGFKAEVKGKEIHFTLGFSHPVVFKLPDGVTAEVDAKQTKLTIRSVDKHLLGLTAAKVRALRPPEPYKGKGIKYADETIRRKEGKTGAA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.552 kDa

MSRVGKMPVKIPEKVKVSVDGNVVKVEGPKGKMHFPTNPLVSVQVDKGEVKVARQDESHVAKGLHGLTRTLVKNALEGVVKGYEKGLEINGVGFKAEVKGKEIHFTLGFSHPVVFKLPEGVTAEVDAKQTKLTIRSVDKHLLGLTAAKVRDLRPPEPYKGKGIKYADETIRRKEGKTGAA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.424 kDa

MSRIGKLPVKIPEKVKVSVDGNLVKVEGPKGKMSFPTNPRVKVAVDKGEVQVTRPDDSPESKGLHGLTRTLVKNALDGVVKGYERGLEINGVGFKAEVKGKEIHFALGFSHPVVFKLPEGVTAEVDAKQTKLTVKGVDKHVLGLTAAKIRALRPPEPYKGKGIKYAEEIIRRKEGKTGAA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.462 kDa

MSRVGKLPVKIPEKVKVSVDGNVVKVEGPKGKMHFPTNPLVSVQVDKGEVKVARQDESHVAKGLHGLTRTLVKNALEGVVKGYEKGLEINGVGFKAEVKGKDIHFTLGFSHPVVFKLPDGVTAEVDAKQTKLTIRSVDKHLLGLTAAKVRALRPPEPYKGKGIKYADETIRRKEGKTGAA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.542 kDa

MSRIGKLPIAIPAGVTFTVTPDNVVTVKGSKGQLVKAMAKDINIAVEDNSVVVTRNDDEKKSRSLHGLTRALINNMVVGVTEGYSKTLELIGVGYRAQLQGKKLVMNLGFSHPVEIEAVEGVTFETPAATKVVIKGIDKELVGNVAADIRSWRKPEPYKGKGIKYDNEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.542 kDa

MSRIGKLPIAIPAGVTFTVTPDNVVTVKGSKGQLVKAMAKDINIAVEDNSVVVTRNDDEKKSRSLHGLTRALINNMVVGVTEGYSKTLELIGVGYRAQLQGKKLVMNLGFSHPVEIEAVEGVTFETPAATKVVIKGIDKELVGNVAADIRSWRKPEPYKGKGIKYDNEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.84 kDa

MSRIGRLPIAIPNGVTVTVSPENVVTVKGPKGELTKTMHPNIDIAIEENSVIVTRKNDEKQNRSLHGLTRSLVNNMVVGVTEGYEKKLELVGVGYRAQLQGKKLVLNLGFSHPVEIEAKEGVEFQLDGTNKITVKGIDKELVGAVASDIRSWRKPEPYKGKGIKYENEAIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.699 kDa

MSRIGRLPIPIPKGVEVKVSPDNVVTVKGAKGTLEKKFPPIVNIEVRDGEVVVTRKGDDKEERAMHGTTRAIIANMVKGVTEGFEKALEIVGVGYRAAKQGKKLILNVGYSHPVEIEEEPGIEIIVEGNNRIIVRGADKERVGQVAANIRRVREPDAYQGKGIRYVGEVVRLKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.212 kDa

MSRIGKAPVIFDNTVQVSVSPANEVVVKGAKSSLTIGMKPNVSAKIDGNKVVLTPNDDTKESRAMHGLYRALIQNAVTGVTKGFSRGLELQGVGYRANVAGKKLELSLGFSHPVIFDIPEGIEIKVEKQTSLTVNGPSKELVGQVAAKIRSFRPPEPYLGKGVRYAGEQIRRKAGKSAGK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.943 kDa

MSRIGRLPIKIPDTVKIDVKDNLVIVEGIRGRLVQNIKDSINVKVENGSVIVGRVFNDKKAKAYHGLYRSLIFNMIKGVTEGFSKSLTINGIGYRAEQQGNSLFLSLGYSTQFEYVIPDGVSVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEIIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.918 kDa

MSRIGRLPIKIPDTVKIDVKGNLVIVEGTRGKLVQDIKDSINVKVENGSVIVNRAFNDKKTKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLFLNLGYSTQFEYVVPDGVSVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.938 kDa

MSRIGRLPIKIPDAVKVDVKDNLVIVEGIRGRLVQDIKDSINVKVENGSVIVDRVLNDKKAKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLFLSLGYSTQFEYVIPDGISVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.938 kDa

MSRIGRLPIKIPDAVKVDVKDNLVIVEGIRGRLVQDIKDSINVKVENGSVIVDRVLNDKKAKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLFLSLGYSTQFEYVIPDGISVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.169 kDa

MSRIGKLPIKIADSVKVDIKDNFITVEGKRGKLSQEINSSIRVKIEDNNIIVERAFNDKQTRAFHGLYRSLIFNMVKGVSDGFSKSLTINGIGYRVEQQGNSLFFNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRSLKVPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.411 kDa

MSRIGKKPVQIPEKVEVSVKGDLISIKGPKGSLDRSLHPAVKLAIENGMVNVSVTDDQDRKTVALQGLFRSLVANMITGVSVGYEKKLLLNGIGYRAEVNGNTVVLNVGYSNPVNFELPKGISALVEKNTTLSLSGIDKEIVGETAARIRRIRPPEPYKGKGIMYSDERIIKKAGKAAAK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.818 kDa

MSRIGKKPVPIPQNVQVEIKDGNCVLVKGPLGQLEKTFSPLLTIKKVDNQIVVERPNDEKFVKALHGLTRALINNMVLGVTQGFEKRLELQGTGYRARVQGNKLILEVGFSHPVELEIPTGLTVTVQDNTKISVKGIDKELVGQFAAIVRSVRPAEPYKGKGIRYEGEKIRQKAGKAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.792 kDa

MSRIGRKPVPIPQNVQVEIKDGNCVSVKGPLGQIEKTFSPLLTIKKVDNQIVVERPNDEKFVKALHGLTRALINNMVLGVTQGFEKRLELQGTGYRARVQGNKLVLEVGFSHPVELEIPTGLTVSVQDNTKISVKGIDKELVGQFAAIVRSVRPAEPYKGKGIRYEGEKIRQKAGKAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.454 kDa

MSRIGKKPIPIPDKVTVTLNGANVAVKGPKGSLERTLPEKVTVTQEDNTIVVSPVDNSRTARERHGLCRTLVANMIEGVSQGYSKQLEIIGVGYRAQVQGNKLTLNVGYSKPVEMQMPEGVTAAMGEKNTQVIISGIDKEVVGNTAAKVRAVRPPEPYKGKGIRYQGEYIRRKAGKAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.641 kDa

MSRIGRLPIPVPKGVQVQVSPGLVKVKGPKGELSVPVSPELKVVVEENVVRVERPSDERRHRSLHGLTRTLIANAVKGVSEGYVKELLIKGIGYRARLVGRSIELTVGFSHPVVVEPPEGITFEVPEPTRIRVLGIDKQKVGQVAADIRAIKKPSAYHEKGIYYADEPVRLKPGKAGAKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.372 kDa

MSRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERKAKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEGITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRRKAGKAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.766 kDa

MSRIGRLPIEIPKGVEVKVSPDNVVTVKGTKCTLEKKFPPIVNIEVKDNQVIVTRNGDDKEERAMHGTTRAIIANMVKGVTQGFEKTLEIVGIGYRAAKQGKKLVLNVGYSHPVEIEEEPGIEIVVEGNNKIIVRGADKEKVGQVAANIRRVREPDAYQGKGIRYAGEVVRLKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.732 kDa

MSRIGRLPIEIPKGVEVKVTPDNVVTVKGSKGTLEKKFPPIVNIEVKDNQVIVTRKGDDKEEKAMHGTTRAIIANMVKGVTEGFEKALEIVGIGYRAAKQGKKLVLNVGYSHPVEIEEKPGIEIIVEGNNKIIVRGIDKEKVGQVAANIRRVREPDAYQGKGIRYAGEVVRLKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.532 kDa

MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.532 kDa

MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.532 kDa

MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.672 kDa

MSRIGRKPIQIPDNVNVTVENRQIIVKGPKGQLSYSLPEGIGITIDNKTMLITRESDLSKQRALHGLARSLISNMVTGVSQGFTKALQIYGVGYRAQVSGNKIILNIGYSHPVEFVLPEGIKATVDEKQTTITLHGIDKQLVGQIAANLRAIRPPDAYKGKGIRYTDEVLKLKPGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.191 kDa

MSRIGKLPIKIVDSVKVDINDNIVTVEGKRGKLSQEINSRIRVRVEDSNIIVERSLDDKQTRAFHGLYRSLIFNMVKGVSDGFSKSLTINGIGYRVEQQGTSLFFNLGYSTQFEYVIPEGVNIRLEGNTKIAVEGIDKCRVGQVAAEIRSLRVPEPYKGKGIRYDNEVSRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.168 kDa

MSRIGKLPIKIADSVKVDIKDNFITVEGKRGKLSQEINSSIRVKIEDNNIIVERAFNNKQTRAFHGLYRSLIFNMVKGVSDGFSKSLTINGIGYRVEQQGNSLFFNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRSLKVPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.037 kDa

MSRIGKLPIKIVDSVKVDIKDNIVTVEGKRGKLSQELKSSIKVRVEDSNIIVERSFDDKQTRAFHGLYRSLISNMVKGVSDGFSKSLTISGIGYRVEQQGTSLFFNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRGLRVPEPYKGKGIKYDNEVIRRKVGKSGVKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.694 kDa

MSRIGKSPVTIPEGVTVDHKDGVVTVKGKLGELKQEIRDIDVKIEDNVITFERSSEKSDQKAKHGLYRALVNNMIEGVTNGYTKSLELVGVGYRATNQGNKLDLAVGYSHNIVLDLAPEVKVETISEKGKNPIVKVTSHDKQLVGQVAAKIRSFRAPEPYKGKGIKFVGEQLRRKAGKSA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.379 kDa

MSRKGKLPISLPNGVEVKVSNTEVAVKGPKGALTQKLIPGVNVNVEGNEVLVSLADEEAKLAHFHGLYRTLIHNMVVGTTEGFEKKLEMIGVGYRAAVQGDLLDLQLGFSHPCKLPIPKGLAVKVDKNTLITISGFDKHLVGQFAATVRSQRPPEPYQGKGIRYAGEFVRKKAGKAAAKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.966 kDa

MSRIGVKPIIIPAGVEVTIAEGNLVTVKGPKGTLTKQLSAELNIKKEENTIMVERPTDNKKHRSLHGLTRTLLDNMVVGVNTGFEKKLELKGVGYRAQKQGKKLVMNLGFSHPVEMEDPEGITVEAPNQTELIVKGIDKQLVGNYAAKIRAWRKPEPYKGKGIKYVDEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.739 kDa

MSRIGRMPIAIPAGVTVEVAENNKVTVKGPNGTLDRVLPAEMDIKVEGDTVVVTRPNELKRMKSLHGLTRTLIANMVTGVTTGYQKVLEINGVGYRAAKNGKELTLTLGYSHPVVMKDPEGVETILEGQNKITVKGIDKEKVGQYAAEIRDKRRPEPYKGKGIKYSDEVIRRKVGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.331 kDa

MSRIGRKSIPVPTGVDVTIAGQTVTVKGPKGELSHTIAEPITIDRAEDGQLNVARPNDERKAKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEGITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRRKAGKAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.527 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALVNNMVTGVNEGYVKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.555 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALINNMVTGVNEGYIKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.886 kDa

MSRVGRLPIAIPADVTVTVTPDNLVTVKGPKGELVKTMHKDISIAVENNEVIVTRHSEQKDHRALHGLTRALINNMVIGVKQGYQKTLDLVGVGYRAQLQGKKLVMNLGYSHPVEIEPIDGITFETPAATRVIVSGIDKEKVGFAAADIRKWRVPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.679 kDa

MSRVGRLPIAVPAGITVTVTPDNVVTVKGPKGELVKTMHKDINIAVENNEVIVTRPSDQKAHRALHGLTRALINNMVIGVNEGYQKTLELVGVGYRAQLQGKKLVMNLGYSHPVEIEPIDGITFETPAATKVIVKGIDKEKVGAAAADIRKWRLPEPYKGKGIKFENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.693 kDa

MSRVGRLPIAVPAGITVTVTPDNVVTVKGPKGELVKTMHKDINIAVENNEVIVTRPSDQKAHRALHGLTRALINNMVIGVNEGYQKTLELVGVGYRAQLQGKKLVMNLGYSHPVEIEPIEGITFETPAATKVIVKGIDKEKVGAAAADIRKWRLPEPYKGKGIKFENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.527 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALVNNMVTGVNEGYVKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.527 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALVNNMVTGVNEGYVKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.527 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALINNMVTGVNEGYVKTLELVGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.499 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELAKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALINNMVTGVNEGYVKTLELVGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.531 kDa

MSRVGKLPVAIPNGVTVTVTPDNVVTVKGSKGELVKAMSNKINIAVEDNSVVVTRDNDHKDVRALHGLTRALINNMVTGVNEGYVKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVSGVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.306 kDa

MSRIGNRILTIPAGVEVSVASDNTVTVKGSKGTLTQKFAEVITIKVEGAELSTTRANEIKHTKQLHGTTNSLLQGMLIGVSEGFKKTLDINGVGYRAALAGSKLNLSLGYSHPVEYTIPQGITVECPKPTQIIISGIDKQVVGQVAAEIRSYRRPEPYKGKGIKYSDEIIIRKEGKAAGK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.747 kDa

MSRIGKMPVQLADQAKIEIKDNVITVSGPKGTLQQQLVPEVSVDIADGQITVTRADDTKRSRAMHGLYRMLVSNMVDGVTKGFTRKLLISGVGFRAEMKSDLLALTLGYSHQIYFKAPEEVTIACPDPTTIEISGIDKALVGQVAAKIRSFRKPEPYRGKGIKFSDEVVRRKEGKTAGKK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.534 kDa

MSRIGKSPIVIPAGVTVEVKDGIITVKGKKGQLVQEFSDVNVTVEGDQVLVERSSDHKDHRAKHGLFRSLISNMVVGVSEGFTKELELVGVGYRASNQGQKLDLALGYSHNIVLEIAPEVSLETISEKGKNPIVKLTSFDKQLLGQVAAKIRGFRKPEPYKGKGVKFVGEVLRRKAGKSA

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.34 kDa

MSRVGNRVLVVPAGVTVDISASNFVSVTGKLGKLERAFSPKVKITLQDNTLTTQRLNEEKATKQLHGTTNALLANMLKGVSEGFQINLEIKGVGYKAELKGNKLVVAAGYSHLVTLDIPSNVEVKVPKPVEISVKGIDKQAVGAFAAVVREIRKPNPYSGKGISYKGEKIRRKEGKTASK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.837 kDa

MSRIGRLPIAVPSGVEVKLDGQYVEVKGPKGTLNFTVREPITVSKNDEGAILVERPDDERENRSLHGLTRTLINNMVIGVTEGYEKKLEIQGVGYRVLSKGPKQLEFNLGFSHPVIVDAPEGITFAVENPTKFSVQGIDKQVVGETAANIRKIRKPEPYKGKGVRYEGENVRRKVGKAGK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.647 kDa

MSRIGNRLLQIPNGVEVKIAENNLVTITGSKGTLSKQFSPLIKIEVEENKLITKRLNEQKHTKQLHGTTNSLLQGMLTGVSEGFKKELQITGVGYKAAVNGSKLNLSLGYSHPVEFEIPDGVVIQAVKPTELAITGIDKQLVGQVAANIRAYRKPEPYKGKGIKYKNETIIRKEGKAAGK

rplF

50S ribosomal protein L6

180 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.718 kDa

MSRIGNRLLQIPNGVEVKIAENNLITITGSKGTLSKQFSPLIKIEVEENKLITKRLNEQKHTKQLHGTTNSLLQGMLTGVSEGFKKELQITGVGYKAAVNGSKLNLSLGYSHPVEFEIPKGVEIQAVKPTELVISGIDKQLVGQVAANIRAYRKPEPYKGKGIKYKNETIIRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.245 kDa

MSRVGKKSITLPDKVTVKVNGSSVQVEGPKGKLSWTLPEGITATVEGNQLSVDRAGESRQLRALHGTNRSLLNNMVIGVSEGFVKNLEIVGVGFRAAVKGNILDLNLGKSHPINQVIPEGLKVTVTENTKVTVEGIDKQVVGQFAAEVRAYYPPEPYKGKGVRFVGEVIRRKEGKSVGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.78 kDa

MSRIGLKPIEVPQGVEITVDEKNIVTVKGPNGQLSEKIHRDITVETEANVINVVRPTENKKHKSLHGLSRTLVANMVEGVTKGYEKKLELVGVGYRATMQGKKLVLSLGFSHPVEIDQPEGLTIEVPSQTQVTVKGIDKQQVGNFAAKIREYRKPEPYKGKGVRYAGEVVRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.972 kDa

MSRIGLRPIEIPQGVEVKIDEKNFAVVKGPKGTLEQQLSKDMEIKIEENVINVVRPTDNKKHKSLHGLTRTLLSNMVEGVTKGYEKKLELVGVGYRANKQGDKLVLTLGFSHPIEMVDPEGITVEVPSQTEIFVKGINKQVVGNYAAKIRELRKPEPYKGKGVKYANEVIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.557 kDa

MSRVGRLPIEIPNGVNVTVTPENVVTVKGPKGELTKAMHEDMNIAVEENNIVVTRPSENVQHKALHGLTRALINNMVVGVTQGYEKTLELVGVGYRAQLKGKDLTLNLGYSHPVEIKAVKGVEYKVPEPTKVVVSGIDKELVGSVAANIRVWRKPEPYKGKGIKYAGEVIRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.381 kDa

MSRVGKMPIAIPAGVTVTVTPENVVTVKGPKGELVKAMHKDINIAVEDAQVVVTRPSDVKEHRALHGLTRALLNNMVVGVSQGFSKTLELNGVGYRAQLQGKKLVMNLGYSHPVEVEAVDGVDFKLDGTTKVIVEGIDKEKVGAVAANIRSWRKPEPYKGKGIKYSDEVIRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.381 kDa

MSRVGKMPIAIPAGVTVTVTPENVVTVKGPKGELVKAMHKDINIAVEDAQVVVTRPSDVKEHRALHGLTRALLNNMVVGVSQGFSKTLELNGVGYRAQLQGKKLVMNLGYSHPVEVEAVDGVDFKLDGTTKVIVEGIDKEKVGAVAANIRSWRKPEPYKGKGIKYSDEVIRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.381 kDa

MSRVGKMPIAIPAGVTVTVTPENVVTVKGPKGELVKAMHKDINIAVEDAQVVVTRPSDVKEHRALHGLTRALLNNMVVGVSQGFSKTLELNGVGYRAQLQGKKLVMNLGYSHPVEVEAVDGVDFKLDGTTKVIVEGIDKEKVGAVAANIRSWRKPEPYKGKGIKYSDEVIRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.432 kDa

MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQHSKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKSISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKGVKYAGEQIVRKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.432 kDa

MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQHSKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKSISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKGVKYAGEQIVRKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.432 kDa

MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQHSKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKSISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKGVKYAGEQIVRKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.432 kDa

MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQHSKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKSISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKGVKYAGEQIVRKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.6 kDa

MSRVGKSIIKLPAKVEVKADAEALTIKGPLGELKTPIYEGVSANVENGELVFTRKSEDQKTVALHGLVRSLAMNCVKGVTSGWEKNLEITGVGYRAQKRGKDLVMALGYSHEVVFPEPNGIKIEVADQLKIKVSGIDRQLVGQVAADIRSKRPPEPYKGKGIKYQNEYIRRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.778 kDa

MSRIGKAEIKLPDKVEVKQENANIKVKGPLGELSTPIFEGLSVKNENGIVKLERSNEDQKVVALHGLTRALLMNCVKGVSQGWEKNLEINGVGYRAQKRGEDLVMSLGYSHEVVYKAPKGIKIDVQEQLKIKVTGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKKKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.6 kDa

MSRVGKSIIKLPAKVEVKADAEALTIKGPLGELKTPIYEGVSANVENGELVFTRKSEDQKTVALHGLVRSLAMNCVKGVTSGWEKNLEITGVGYRAQKRGKDLVMALGYSHEVVFPEPNGIKIEVADQLKIKVSGIDRQLVGQVAADIRSKRPPEPYKGKGIKYQNEYIRRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.782 kDa

MSRIGKAEIKLPDKVEVKQENANIKVKGPLGELFTPIFEGISVKTENGIVKLERSNEDQKVVALHGLTRALLMNCVKGVSQGWEKNLEITGVGYRAQKRGEDLVMSLGFSHEVVYKAPKGIKIDVQEQLKIKVSGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKKKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.782 kDa

MSRIGKAEIKLPDKVEVKQENANIKVKGPLGELFTPIFEGISVKTENGIVKLERSNEDQKVVALHGLTRALLMNCVKGVSQGWEKNLEITGVGYRAQKRGEDLVMSLGFSHEVVYKAPKGIKIDVQEQLKIKVSGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKKKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.425 kDa

MSRIGKVPVSVPGGVHVRVSSGVVEVEGPKGVLSCAFLPVVTVRVEQEYVIVARCDDSKRARACHGLYRKLLSNMVVGVSEGFSKTLVITGIGYRAEVQGRVLVMALGYSNDFTVLIPSGIEVRVESSTRVIVSGVSKERVGEFAAQLRRLRLPEAYKGKGIRYDYETIVRKVGKSGVK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.425 kDa

MSRIGKVPVSVPGGVHVRVSSGVVEVEGPKGVLSCAFLPVVTVRVEQEYVIVARCDDSKRARACHGLYRKLLSNMVVGVSEGFSKTLVITGIGYRAEVQGRVLVMALGYSNDFTVLIPSGIEVRVESSTRVIVSGVSKERVGEFAAQLRRLRLPEAYKGKGIRYDYETIVRKVGKSGVK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.49 kDa

MSRIGKLPIPIPKKVTITIEGQKVTVKGPLGELSRVLPPEIAVKEQENTIIVKPQEQSRRARQRYGLCRTLVANMVEGVSKGYEKRLVIQGVGYRAQVQGKTLVLNVGYSKPVEMPAPEGINIAVENNTNVIVNGINKELVGNTAAKIRAVRPPEVYKGKGVRYAGEVIKLKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.984 kDa

MSRIGKLPVDIPEKVDVSVNDNLVTVKGPKGELTKEFNNKKVTVEVKDGQVLVRRVHDKDKDARAFQGLTRSLIDSMVEGVTNGFEKKLEMVGVGYNAKKKGKDLELEVGYSHPVIIEAEDGIEFDVEKNNKIVVRGIDKQQVGEMAAKVRAVRKPEPYKGKGIRYEGEHIRRKEGKTG

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.371 kDa

MSRIGKKPIAVPSGVEITIDGQHVSVKGPKGTLTHTVAEPITVTRGEDGQLEVTRPNDERRNRSLHGLTRTLIANMIEGVTKGYEKKMEIFGVGYRVQAKGSNLEFALGYSHPVPVEAPEGITFAVESPTKFSVSGIDKQKVGQISAVIHGLRKPDPYKGKGIRYAGEVVRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.158 kDa

MSRIGKLPVAVPSGVDVAIDGARVTVKGPKGTLSHTVAAPITVEKGDGVLDVKRPDDERESKALHGLTRTLVNNMVVGVTEGYEKKLEIVGVGYRVLSKGPTQLEFQLGYSHPITFNAPEGITFAVEGPTRLGVQGIDKQLVGEVAANIRKLRKPEPYKGKGVRYAGEHIRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.445 kDa

MSRVGKKLLEIPSGVTVTLNEGNTVAVKGPKGELTRTFHPDMEIKIEDNVLTVTRPSDHKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRAAKSGNKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.024 kDa

MSRIGKIPVQVPSGVDVDIADRVVTVKGPKGTLTHRVPAPIVVARGDDGALVVTRPDDERTSRSLHGLTRTLLANLVTGVTQGYQKNLEIVGTGYRVTAKGSSLEFALGFSHPVTVSAPEGITFAVESPTKFSVAGIDKQQVGEVAANIRKIRKPEPYKGKGVRYAGEQVRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.975 kDa

MASHIGKLPIEIPAGVEVTINGQEFAAKGAKGSDSYTIPEGVTAKVEGNEIIVTANDDLRPTRAKHGLARSIVASMVKGVHDGYSKSLDIVGTGYRAQMKGKGIEFSLGYSHTITVNPPEGITLELPNPNQVIVKGTDKQAVGQVAANIRKLRAPEPYKGKGIKYSDEVIRRKAGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.955 kDa

MASHIGKLPVTIPAGVEVKIDGQSFTAKGAKGTDSYEIPEGITAVVEGNEVVLTPADDLRPTRAKHGLARSIVAGMVKGVHEGYAKTLEIVGTGYRAQMKGKGIEFSLGYSHTITVEPPAGIEFELPNPNQVIVKGIDKQAVGQCAANIRKLRAPEPYKGKGIKYADEHILRKAGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.861 kDa

MASHIGKLPIAIPAGVEVKIEGQNFSAKGAKGSDSYVVPEGITAAVEGNEIVLTAADDLRPTRAKHGLARSIMAGMVKGVHDGYSKTLEIVGTGYRAVAKGQGIEFFLGYSHTITVNPPEGITLKVTDANHVVVEGTDKQVVGQVAANIRKLRAPEPYKGKGIKYSDERILRKAGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.861 kDa

MASHIGKLPIAIPAGVEVKIEGQNFSAKGAKGSDSYVVPEGITAAVEGNEIVLTAADDLRPTRAKHGLARSIMAGMVKGVHDGYSKTLEIVGTGYRAVAKGQGIEFFLGYSHTITVNPPEGITLKVTDANHVVVEGTDKQVVGQVAANIRKLRAPEPYKGKGIKYSDERILRKAGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.845 kDa

MASHIGKLPIAIPAGVEVKIEGQNFSAKGAKGSDSYVVPEGITAAVEGNEIVLTAADDLRPTRAKHGLARSIMAGMVKGVHDGYSKTLEIVGTGYRAVAKGKGIEFFLGYSHTITVNPPEGITLKVTDANHVVVEGTDKQVVGQVAANIRKLRAPEPYKGKGIKYADERILRKAGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.042 kDa

MSRIGKQPIPVPSGVEVKLGADVVEVKGPKGSLTTPVSPLLKYEIQDGSVVITRVEETKKASAQHGLRRTLLANCIEGVSKGFSKVLEVNGVGYKVAVKGNNIELALGFSHPVVIELPKGIEAAAAGNKLTISGFDKQLVGEVAANIRRVRPPEPYKGKGVKYEHEQIRRKAGKSGGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.364 kDa

MSRIGKLPIPVPNGVEVKIGTDVVEVKGPKGSLSTPVCSLLQYEQADGHVVLTRIEDDRVTRAQHGLRRSLLSNCIDGVTKGFSKALEVIGVGYRVAVKGNIIELQVGYSHPVLVELPEGLKATVEGQVLTISGIDKELVGEMAARIRRIRKPEPYKGKGIKYATETIRRKVGKSGGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.062 kDa

MSRIGKREIELPAGVSVELASDAVVVKGPKGQLSTPTHPKIAYAVADGKVQVSRTDDTRVARAQHGLRRTLLANLVEGVSKGFTKTLEVIGVGYKVATAGNTVSLAVGFSHPVDFKLPEGIEAKVEGNKLTLSGIDKVLLGETAARIRRVRPPEPFKGKGIKYENEVIRRKAGKSGGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.133 kDa

MSRIGKQPIPIPSGVEVKIGNDVVEVKGPKGALTTPVCSVLSYEVTDGKVVITRLDETRQTRAQHGLRRTLLANCIEGVSKGFSKTLEVVGVGYKVAVKGDVVDLSVGYSHPVLIDLPAGISAKAEGNKLTISGVDKELVGEVAAQMRRVRKPEPYKGKGIKYDNEQIRRKAGKSGGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.133 kDa

MSRIGKQPIPIPSGVEVKIGNDVVEVKGPKGALTTPVCSVLSYEVTDGKVVITRLDETRQTRAQHGLRRTLLANCIEGVSKGFSKTLEVVGVGYKVAVKGDVVDLSVGYSHPVLIDLPAGISAKAEGNKLTISGVDKELVGEVAAQMRRVRKPEPYKGKGIKYDNEQIRRKAGKSGGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.647 kDa

MSRIGKLPIKLPPGIKVSIEGNNVTLEGKKGKLFHRLPEFLKVHQQDGSLILENTADSRQSKAMYGLHRSLLNNAVMGVHEGFQKKLEINGIGFRAAVEGKKLVMNLGFSHPVVYEIPEGISVKVQDNTKLTIEGIDKCLVGAVAADIRGFYVPEPYKGKGIRYAGEVIRRKAGKTAQK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.359 kDa

MSRIGKIPVTVPAGVDVTISGQDVTVKGPKGTLALTISEPIAIEKAEDGSLSVTRPDDERRSRALHGLSRTLVANIITGVTEGYTKKMEIHGVGYRVALKGKDLEFALGFSHPVPIEAPEGITFVVESPTRFSVSGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.306 kDa

MSRIGKIPVTVPGGVDVSIDGQDVTVKGPKGSLALTISEPIAIAKNDDGTLSVTRPDDERRSRALHGLSRTLVQNLITGVTDGYTTKMEIHGVGYRVALKGKDLEFALGYSHPVPIEAPEGITFAVESPTKFSVSGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.348 kDa

MSRIGKIPVTVPGGVDVSIDGQDVTVKGPKGTLALTISEPIVIAKNDDGTLSVTRPDDERRSRALHGLSRTLVQNLITGVTDGYTTKMEIHGVGYRVALKGKDLEFALGYSHPVPIEAPEGITFAVESPTKFSVSGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.525 kDa

MSRVGKLPITIPKGVDVSLDEPLLTIKGPKGTLARRMPGDVEVHLEQGAVLIRRKDESNKSRSLHGLVRALVNNMVHGVSEGFVISLEIQGTGYRADAQNNVLNLSLGYSHPIQFVLPEGIKGAVDRNTIRLEGIDKELLGQTAARIRALRPAEPYKGKGIRYAGEHIHRKVGKTGSKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.198 kDa

MSRIGKRPIPIPAKVSVAIDGRLVSVKGPKGELSRELPSGVVVTQEDGNIIVSRADESRLARQRHGLSRTLVANLVEGVDSGFQKRLEIIGVGYRAQVQGTTLILNVGYSNPVQIEPPEGIQFVVENNTNVVVSGISKEVVGNTAARIRAVRPPEPYKGKGIRYAGEVVLRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.056 kDa

MSRIGKSPIPIPDKVSVSLDGLAVTVKGPKGELKRTLPDGVTVNQVDNTIVVAPTSEKRQSRERHGLCRTLVANMIEGVSKGYSKKLEIVGVGSRAQVKGKTLVVSAGYSHPVEMLAPEGITFAVENNTNVTVSGTDKELVGNEAAKIRAIRPPEPYKGKGIKYAGERILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.251 kDa

MSRIGKNPVPVPDKVTVSLDGLTVKVKGPKGELERTLPDGVSVSQDNNCIVVAPSTSKRFSRERHGLCRTLVANMIEGVNNGYSKSLEIVGVGSRAQVKGKTLVVSAGYSHPVEMEPPEGITFKVENNTKVIVSGIDKELVGNEAAKVRAIRPPEPYKGKGIKYEGERIMRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.118 kDa

MSRIGKNPVPIPEKVSVEISGLTVKVKGPKGELERVLPDGVSVSQADNAVTVSPSDTSRRSRERHGLCRTLVANMVEGVSKGFSKKLEIIGVGYRAQVKGKKLVVSAGYSHPVEMDAPEGVTFAVENNTLVTVSGADKELVGNEAAKVRGIRPPEPYKGKGIKYQGERILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.951 kDa

MSRIGKNPIPIPDKVNVTLSGLAVTVKGPKGELKRTLPSGVSVNQVDNSIVVAPTSTKRSSRERHGLCRTLVANMVIGVSQGYSKKLEIVGVGSRAQVKGKTLVVSAGYSHPVEVVPPEGITFTVENNTNVTVSGTDKELVGNEAAKIRAIRPPEPYKGKGIKYAGERILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.053 kDa

MSRIGKNPVPVPDKVTVSLDGLTVKVKGPKGELERTLPEGVSVSQEANTIVVAPTSTKRISRERHGLSRTLVANMIEGVHNGYSKALEIVGVGSRAQVKGTTLVVSAGYSHPVEMPAPAGITFKVENNTRVIVSGIDKELVGNEAAKVRAIRPPEPYKGKGIKYEGEHILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.33 kDa

MSRIGKKPISLPAGVEVSIKDNAISVKGPKGVLEWALPEGITVVQEGNELVVKRPSDIKQHRAMHGLSRALIANMVQGVSAGFEKKLELVGVGYRAQMQGKKLVISIGFSHPVEVEPPEGIEFEVPAVTRITVKGIDKQLVGNTAAHIRAIRKPEPYKGKGIKYENEVIRRKAGKAGGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.667 kDa

MSRIGKRPIPLPAKVSVDIQGSHLSVKGPKGSLERQLPEKVIVAQEGETITVTRQDESRTARERHGLVRTLVANMVDGVAQGFERRLEIQGVGYRAQAQGNKLTLNVGYSKPVEMTMPQGIEVKVENNTQVIVSGIDKELLGNTAAKIRAVRPPEPYKGKGIRYQGEYVRRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.53 kDa

MSRIGKVPIPIPDKVNVTIKGQAVTVKGPKGELSREITPEVAIEQADNLVTVTRRNESRIARQRHGLSRTLIANMVEGVSKGFEKKLQIQGVGYRAQVQGRNLILNVGYSNPVTIEPPEGVQVAVESNTNVIVSGINKEVVGNTAARIRAVRPPEPYKGKGIRYADEYVRRKVGKAGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.723 kDa

MSRIGNKVIVVPAGVTVDIKEGNFLTVKGPKGQLEKQLNSDLSITLEGNLLTVKRPNNEMFMRKIHGTTRALLFNMVHGVSEGFSKKLEIKGVGYRAQLQGNTLVLQLGFSHNIEMPLPEGISLDVPKNTEITVNGIDKAVVGQFAAEIRKHRKPEPYKGKGIRYVDEYVARKAGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.466 kDa

MSRIGRKPIEVPAGVTVNVDSNNLVTVKGPKGTLSESIRPEVTVNINGATVEITRVNDSRQARAFHGLSRTLVANMVDGVTKGFEKTLEMNGTGYRATLDGKTLVLSLGFSHPVRVEPYEGNSFEVAERRVVIKGPNKQKVGDQAANIRKLRPPEPYLGKGIKYSDEVIRRKAGKAGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.174 kDa

MSRIGRLPITVPAGVDVTIDGAAVTVKGPKGELSHTVAAPISVERTEDGTLQVTRPDDERVSRSLHGLTRTLISNMVEGVTKGYEKKLEIVGTGYRVTPKGSDLEFALGFSHPVVVKAPAGITFAVENNTRFSVAGIDKQQVGEIAANIRKLRKPDPYKGKGVRYAGEQIRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.075 kDa

MSRIGKKPIAVPKGVTFNVQGDVVTVKGPKGTVSNHLPGGVKLALEDGNIVVTRDDESKRAIHGLVRALVNNAVEGVTKGWTRNLEIVGIGYRAELKGKGTVVFTLGYSHPIEYPLPTGIEAAVDAKQTALTITGIDRQKVGQVAAEMRALRPPDPYKNKGVRYAGEKLKKKVGKTGAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.477 kDa

MSRIGKLPITVPSGVEVTIDGQDVTVKGPKGSLVQRIAEPITVEKDDDGAILVKRPDDERNSRSLHGLSRSLVNNMVVGVSQGYQKDLEIHGVGYRVQQKGSNLEFALGYSHPVVVEPPEGIEFATDGPTKLSVKGIDKQLVGEIAARIRKLRRPDPYKGKGVRYAGENIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.507 kDa

MSRVGKMPVAIPAGVKVNVANGIFTVEGPKGKLSQDYHTEAVDFKIEGDHVLVTRKDDELQTRAYHGLYRSLLNNMVTGVSTGFTKTLVINGVGYRAEVQGKLLVMALGYSNDFSVIIPEGIEVKVDQLKVIISGASKEAVGQFASQVRKLRGPEPYKGKGIRYEDEIIKRKVGKSGVK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.009 kDa

MSRIGKRPIPVPAGVTVAIDGSAVTVKGPKGELSRVLPADIVVSQEGAELLVKRPSDEERHKALHGLTRTLVANMVEGVTTGFKRVLEITGVGYKAEIKPYGALLSLGFSHQIEYKAPQGVQITAPNPTTVVIEGASKEHVGQVAAEIRSLRKPEPYKGKGVKYQGEVVRRKAGKAGGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.23 kDa

MSRIGKLPIAIPAGVKVIYNAPEIKVEGPKGKLARNIGEGVAIDVTAQAVTVTRHDDTIKSRSAHGLTRTLINNMVIGVSKGFETLLEINGVGYRAEVKGNVLNLALGFSHPVNFELPTGITVEVEKMTKLKVMGIDKEVVGETAAKIRAFRPPEPYKGKGVKYADETILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.413 kDa

MSRIGKLPIEIPKGVKISYTDSNLQVVGPKGTLSRTIMSGVTIEMTENHISVSRDDDGIKSRSAHGLTRTLINNMVTGVTKGFETALEINGVGYRAELKGDVLNLSLGYSHPINFSLPKGINVEVDKMTKILVKGVDKELVGQTAAKIRDFRGPEPYKGKGVKYADETILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.12 kDa

MSRIGKLPIEVPKGVTVTFVDSVLTVKGPKGELCRTIMPEVSVAVEDGKISVTRPDDAIKSRSAHGLTRTLVNNMVVGVTAGYQTDLEINGVGYRAEVKGAELVLSLGYSHPVVFPLPSGITVEVDKMTKLAVKGIDKELVGQTAAKIRSFRGPEPYKGKGIKYATETILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.561 kDa

MSRIGKRPIEIPSGVKVSYVTPILKVEGPKGSLLREIMSDIALEIEEKSVSVNRADDAIKSRSAHGLTRTLINNMVVGVTKGFEKILEINGVGYRAEAKGDVLSLSLGYSHPINFPLPKGITVEVDKMTKVFVRGIDKELVGQTAAKIRSFRGPEPYKGKGIKYADERILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.317 kDa

MSRIGKRPIEIPSGVKVEFSDSVLTIEGPKGKLSRQVMDGVSLEITPSSIEVKRADDGLKARSAHGLTRTLVNNMVVGVTKGFERALEINGVGYRAEAKGDVLNLSLGYSHPINYALPAGIIVEVDKMTKLVVKGIDKELVGQTAAKIRSFRGPEPYKGKGIKYADEKILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.369 kDa

MSRIGKLPIEIPKGVKISYIDSNLMVEGPKGSLGRRIMSGVSIDLTDNTITVSRDNDGIKSRSAHGLTRTLINNMVTGVTTGFETALEINGVGYRAELKGDVLNLSLGYSHPINFQLPKGINVEVDKMTKLLVKGIDKELVGQTAAKIRAFRGPEPYKGKGVKYANETILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.243 kDa

MSRIGKKPIDIPKGVTVSLAGDTVTVKGPKGELTRNIVAGIRLETAGDQILVQCEKEGKQEGAYRGLVRALVANMVEGVTNGFERVLEINGVGYRAEVKGSALNLSLGYSHPIEYALPKGISAEVEKQTKIIVRGIDKELVGATAAKIRSFRKPEPYKGKGVKYAEERIVRKAGKAGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.795 kDa

MSRIGKMPIPLSNQAKIEIKDSNIRVSGPKGTLEQRLTDQVTVSEENGLVTVLRIDDSKKAKAQHGLYRMLISNMVDGVTKGFTRKLEIAGVGYRAELKNDLLALTLGYSHMIYFKAPDEIKIEVPDQVTVLVSGIDKALVGQVAAKIRSFRKPEPYRGKGIKYEGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.362 kDa

MSRIGKLPIDISKDVKLAFSDSILSVQGPLGKLSRRIMPCVNLEITDSCIIVMRNDESGTARSAHGLTRTLVSNMVNGVTKGFQKSLEINGVGYRAEVKGSELVLSLGYSHPVVFTIPAGVTIEVDKLTKVVVKGFDKELVGETAAKIRSFRPPEPYKGKGVKYADETILRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.639 kDa

MSRIGKKPIDIPKGVEVKVGEGNFVTVKGPKGELSYKFNPELKINVEENQVKVERPNDSSFMRAIHGTTRALIANMIKGVTEGFTVELEIVGIGYRANMKGKAIELQLGYSHPIHFEPPEGVQIAVEGNIIKVSGIDKQKVGQVAAKIRDFRKPDPYKGKGIRYKGEVIKLKAGKSVGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.501 kDa

MSRIGNRELKIPVGLEVTIQPNNVIVKGVKGQLEQTIPSVITVVAKEGVVTTTRANDVKHSKQLHGTINSLIQGMLEGVSKGFKKELEINGVGYRAALVGDKLTLSLGYSHPVEYKIPQGITITLPKPTQIIVEGISKQLVGEVAANIRNYRKPEPYKGKGVKYKNEHIIRKEGKSAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.429 kDa

MSRIGNRELKIPVGVEVTIQPNNVIVKSAKGQLEQAIPSVITVAAKEGVVTTTRANDVKHSKQLHGTINSLIQGMLEGVSKGFKKELEINGVGYRAALAGNKLTLSLGYSHPIEYKIPQGITITLPKPTQIIVEGISKKLVGEVAANIRNYRKPEPYKGKGIKYKNKHIIRKEGKSAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.647 kDa

MSRIGKMPIPLSNQAKIEINDSIIRVSGPKGSLEQKLTDQVIITEENSALLVRRIDDSKKARAQHGLYRMLINNMVQGVTNGFTTKLEIAGVGFRAEMKGELLALTLGFSHLIYFKAPEGIKLETPDQVTVLISGIDKALVGQVAAKIRSFKKPEPYRGKGIKYSGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.66 kDa

MSRIGKMPISLSNQAKIEISDANVKVTGPKGTLEQALVAQVTLQEENGVVTVQRVDETKKSKAMHGLYRMLISNMVEGVTKGFTRKLEIAGVGYRAELKNDLLALTLGYSHMIYFKAPDSIKIEVPDQTTILISGIDKALVGQVAAKIRSFRKPEPYRGKGIKYEGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.685 kDa

MSRIGKMPIAIGNEAKIEVKGGIITVTGPKGVLDQPMVEEVRIVEEDGKVLVQRINDSKRARAMHGLYRMLVSNMIQGVTTGFTRKLEIAGVGFRAEMKSDLLALTLGYSHMIYFKAPEGIKMETPDQVTVLISGIDKALVGQVAAKIRSFRKPEPYRGKGIKYEGEIIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.767 kDa

MSRIGKMPIKLAEQAKIEIKDNVISVSGPKGNLEQRLVPEVTVDIADGQVAVTRIDDSKRSRAMHGLYRMLISNMLEGVTSGFSKKLLINGVGFRAEKKAEFLALTLGYSHMIYFKAPEEIAIECPDPTSIVVSGIDKALVGQVAAKIRSFRKPEPYRGKGIRYSDEFVRRKEGKTAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.722 kDa

MSRIGKMPIPLSNQAKIEITDTDLTVTGPKGKLHQALTPQVIITQEDGVVTVQRIDDSKKAKAMHGLYRVLISNMVEGVTNGFTRKLEIAGVGYRAELKNDFLALTLGYSHMIYFKAPDEITIQVPDQTTILVTGIDKALVGQVAAKIRSFRKPEPYRGKGIKYEGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.691 kDa

MSRIGKMPIALAKEAKLEISEGNLRVSGPKGVLEQALVEEVKVLQEEGLVKVERINDSKRSRAMHGLYRMLLSNMIEGVTKGFTRKLEIAGVGFRAEMKGDLLALTLGFSHMIYFKAPEGVKLETPDPVTVLVSGIDKALIGQVAAKIRSFRKPEPYRGKGIKYEGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.634 kDa

MSRIGKLPVSITKGVKVELKDDKVIVSGPKGTLEQKLRPEVTVSVDGNNVVVTRKDDTRPSKEMHGLYRVLINNMVTGVSTGFTKKLELVGVGYKAEIKKDMLVLSLGFSHQIYFKTPAEIKVEVPAPTNISISGSDKELVGQVAAKIRSFRPPEPYQGKGVKYENEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.688 kDa

MSRIGYKTIVIPEGVTVTRDEDVITVKGPKGELSETFSPDVAMNVNGNEINFEPTGKYDNKMCALHGTQRANLANMIEGVEKGFNKTLKLVGVGYRTQLKGSDLILNVGYSNPVDVKVPEDIDVKVPDNTTIEIAGINKQHVGDFAAKVREIRSPEPYKGKGIRYENEHITLREGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.598 kDa

MSRIGKMPIRLADQAQVEVKENMINVTGPKGALSQALVDEVIVSVADGAVTVQRKDDSKRARAMHGLYRMLVSNMVEGVTKGFTRKLEMSGVGYRAELKGNLLALTLGYSHMIYFQPPAEIKIEVPDPTTVLVSGIDKALVGQIAAKIRSFRKPEPYRGKGIKYEGEVIRRKEGKAAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.361 kDa

MSRVGKQPVEIPSGVTVTVTPDNVVTVKGTKGQLEKAMHKDMKIAVEDNKVVVTRPSDSKNHKALHGLTRALINNMVIGVTEGFSKTLQLVGVGYKAQLKGKSLILNLGYSHPIEVASIEGVTFEIPDANTVVVKGINKELVGSVAADIRTFRKPEPYKGKGIKYSDEVIRRKEGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.516 kDa

MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.516 kDa

MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.516 kDa

MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.516 kDa

MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.516 kDa

MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.509 kDa

MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.406 kDa

MSRTGKKPISLPEKVDVKFEGLSITVKGPKGELQRTLPNGVSLSKDENFIFVKPINEKRQSREMHGLCRSLVANMVEGVSNGFTKKLEIVGVGSRAQVKGKTLVVSAGYSHPVEVVPPEGITFKVENNTNVIVTGPDKELVGNEAAKIRAIRPPEPYKGKGIKYQGELIIRKAGKSGKT

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.075 kDa

MSRIGKQPIPVPEKVAVELDGLSLTVKGPKGELSRTLPEGVSISQVDNSIVVSAINSKRKSRERHGLSRSLVANMVEGVSKGYSKKLEIVGVGSRAQVKGKNLIVSAGYSHPVEVIPPDGITFVVENNTNVTVSGIDKELVGNEAAKIRAIRPPEPYKGKGIKYAGERIIRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.548 kDa

MSRIGKSPVQIPDKVSVDINGLTITVKGPKGELKRLMPEGVDFVQKENQIVVTPSTTKRYSRERHGLCRTLISNMVQGVTDGYSKKLEIVGVGSRAQVKGKTLVVSAGYSHPVEMTPPDGITYKVESNTNVTVSGIDKEIVGNEAAKIRSIRPPEPYKGKGIKYQDERIIRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.436 kDa

MSRIGKTPVLIPEKVTVDLDGLIVTVKGPKGELKRLMPEGVSFDKKDNTVVVSPTTNKIHSRQRHGLCRALIANMVEGVTQGFSKKLEIVGVGSRAQVKGKNLVVSAGYSHPVEMIPPDGITYKVESNTNVTVSGIDKEIVGNEAAKIRSIRPPEPYKGKGIKYHDERILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.228 kDa

MSRIGKKPIPVPEKVAVTLDGLLVTVKGPKGELTRTLPEGVTIDQTDGLIIVSADSEKRKSRERHGLSRTLVANMIEGVNNGYSKQLEIVGVGSRAQVKGKTLVVSAGYSHPVEVIPPEGITFKVENNTNVLVSGIDKELVGNEAAKIRAIRPPEPYKGKGIKYLGERILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.151 kDa

MSRIGKNPIPIPDKVAVTLDGLAVSVKGPKGELSRTLPEGVSVSQVENTIVVTPTSQKRKSRERHGLCRSLVANMVEGVSKGYTRKLELIGVGSRAQVKGKKLVVSAGFSHPVEMDPPEGVTFAVENNTNVTVSGADKELVGNEAAKIRAIRPPEPYKGKGIRYEGERILRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.63 kDa

MSRIGKSPVQIPEKVSVDIKGLSITVKGPKGELKRLMPEGVNFDQKENQIVVTPATTKRYSRERHGLCRTLISNMVQGVTEGYEKKLEIVGVGSRAQVKGKNLVVSAGYSHPVEMTPPDGITYKVESNTNVTVSGIDKEIVGNEAAKIRSIRPPEPYKGKGIKYQDERIIRKAGKSGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.406 kDa

MSRTGKKPISLPEKVDVKFEGLSITVKGPKGELKRTLPNGVSLSKDENFIFVKPINEKRQSREMHGLCRSLVANMVEGVSNGFTKKLEIVGVGSRAQVKGKTLVVSAGYSHPVEVVPPEGITFKVENNTNVIVTGPDKELVGNEAAKIRAIRPPEPYKGKGIKYQGELIIRKAGKSGKT

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.518 kDa

MSRVAKNPVKLPSGVEVKLVGQLLSVKGPKGTLELIIHSSVEVEIVEEAGELRFAARNGDQQTRAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTVLNLALGFSHPVDYELPNGITAETPSQTDILIRGIDKQLVGQVAAEIRDFRRPEPYKGKGVRYADEVVRRKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.626 kDa

MSRIGKKPIELPANVTCERTGNAIKVAGPRGELTTIIPEKVEVVMDQTKVLVKRHSDSREDRSYHGLVRTLIQNMITGVSTGYEKSLEIVGVGFKAEAEGRNLKLTIGYSSPIIYAVPEGIDLKIEKATNIILSGIDKEKVGKVAAEIRRIKKPEPYKGKGIKYANEQVRRKVGKSVGA

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.198 kDa

MSRIGKRPIPIPAKVSVAIDGRLVSVKGPKGELSRELPSGVVVTQEDGNIIVSRADESRLARQRHGLSRTLVANLVEGVDSGFQKRLEIIGVGYRAQVQGTTLILNVGYSNPVQIEPPEGIQFVVENNTNVVVSGISKEVVGNTAARIRAVRPPEPYKGKGIRYAGEVVLRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.71 kDa

MSRIAKQPIVIPSDVSITLIGQMVIVKGSKGELKRLIHDSVLVKSVKSCLVFSSRINSSVKGWAQAGTARSLVNSMIHGVTVGFFKKLKLFGVGYRISINSSKNLNMSLGYSHIIEYVLPFGIFVESISQAEIIVKGINKQLVGQVAANLRAYRKSEPYKGKGIRYSNEIVRVKEAKKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

20.027 kDa

MSRIGLKPIEIPNGVEVKVTEDNLCTVKGPKGELVEQMPKEMIIKVEDNTITVSRPSEIKRHKSLHGLTRTLVFNMIEGVTEGYKKTLIIEGTGYRAAKQGKKLVLNLGYSHTIEKEDPEGISVEVPEQHTLIISGINKQQVGNYAAKIRDLRGPEPYKGKGIRYEDEHIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.649 kDa

MSRVGKRIIQIPSGTEVKIDGSFFEVKGKLGSLSRLFSPFVNIKHENNQISVERLNELKPTKQLHGTTNALIANMVKGVSEGFKKELKIEGVGYKATLKGQNLELAAGYSHPVSLVIPKDLKVEVPKPVNIIISGIDKQVVGEFAAKVRGVRPPSVYSGKGIQYKDEKLRRKEGKKASK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.453 kDa

MSRIGKQPVPVPSGVDVTINGQNLSVKGPKGTLTLDVAEPISVSRAEDGAIVVTRPDDERRSRSLHGLSRTLIANLVTGVTEGYTQKMEIFGVGYRVQLKGQNLEFALGYSHPVLIEAPEGITFAVESPTKFSVSGIDKQKVGQISAVIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.39 kDa

MSRIGKQPVPVPAGVDVTIEGQNVSVKGPKGTLSLAVAEPIVVARDDEGAIVVTRPNDERRNRSLHGLSRTLVANLVEGVTQGYTTKMEIYGVGYRVALKGSNLEFALGYSHPVVIEPPEGITFAVETPTKFSVSGIDKQKVGQISAIIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.39 kDa

MSRIGKQPVPVPAGVDVTIEGQNVSVKGPKGTLSLAVAEPIVVARDDEGAIVVTRPNDERRNRSLHGLSRTLVANLVEGVTQGYTTKMEIYGVGYRVALKGSNLEFALGYSHPVVIEPPEGITFAVETPTKFSVSGIDKQKVGQISAIIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.39 kDa

MSRIGKQPVPVPAGVDVTIEGQNVSVKGPKGTLSLAVAEPIVVARDDEGAIVVTRPNDERRNRSLHGLSRTLVANLVEGVTQGYTTKMEIYGVGYRVALKGSNLEFALGYSHPVVIEPPEGITFAVETPTKFSVSGIDKQKVGQISAIIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.377 kDa

MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.377 kDa

MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.377 kDa

MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.457 kDa

MSRIGKQPVPVPTGVDVMIEGQKVSVKGPKGALDLTVAEPITVSRNDDGAIVISRPNDERRNRSLHGLSRTLVSNLVTGVTEGYTTKMEIHGVGYRVQLKGANLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.32 kDa

MSRIGKQPVTVPSGVDVTIDGQNVSVKGPKGTLTLDVAEPIAVTRDDDGAIVVTRPNDERRNRSLHGLSRTLIANLVTGVTEGYTTKMEIFGVGYRVVAKGSNLEFALGYSHPVLITAPEGVTFAVETPTKFSISGIDKQKVGQIAANIRRLRKSDPYKGKGIRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.217 kDa

MSRIGKLPITVPAGVDVTIDGRTVQVKGPKGSLSHTIAAPIEIAKGEDGVLNVTRPNDERQNKALHGLSRTLVANMITGVTQGYVKKLEISGVGYRVLAKGSNLEFSLGYSHSITVEAPEGITFKVEAPTRFSVEGIDKQKVGEVAANIRKLRKPDPYKAKGVKYEGEVIRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.179 kDa

MSRIGKLPIAVPAGVDVTIDGRTVSVKGPKGSLTHTVVAPIDIAKGEDGVLNVTRPNDERQSKALHGLSRTLVANMITGVTQGYVKKLEISGVGYRVLAKGSNLEFSLGYSHPILVEAPEGITFKVENPTHFSVEGIDKQKVGEVAANIRKLRKPDPYKAKGVKYEGEVIRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

18.994 kDa

MSRIGKLPIQVPAGVDVTIDGRTVAVKGPKGSLTHTVAAPIEVSKGEDGVLNVTRPNDERQNKALHGLSRTLVANMITGVTAGYSKALEISGVGYRVQAKGSNLEFALGYSHPILIEAPEGITFKVESPTKLSVEGIDKQKVGEVAANIRKLRKPDPYKAKGVKYAGEVIRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.521 kDa

MSRIGRLPIPVPAGVDVTIDGRTVTVKGPRGTLTHTIAEPITVEKAEDGTLHVRRPDDENRTRGLHGLTRTLIANMITGVTQGFAKTLEIVGTGYRVQARGSDLEFALGFSHPVVVRPPEGISFEVQTPTRFVVHGIDKQKVGEVAANIRKLRKPEPYKGKGVRYQGENVRRKVGKAGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.366 kDa

MSRIGNKPIPLPAGVKYTHAGGKVVVEGPKGKIEQVIPEGIKLETKDGHIHAIRETEKHAAVHGLTRALVFNAVEGVTKGWSKDLDIVGIGYRAELKGKDMVVFTLGYSHPIEFPLPTGITAVIDPKQTRVTVSGIDRQKVGQVAADMRSLRKPDPYKNKGVRYVGEKLKKKAGKAGSK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.614 kDa

MSRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSEVTVNQEGETVEVQRVDDSRTARERHGLFRTLVANMIQGVSQGFEKRLNIQGVGYRAQAQGSKLTLNVGYSKPVEMTMPQGINVAVENNTQVVVSGIDKEIVGNIAAKIRGVRPPEPYKGKGIRYQDEYVRRKAGKAGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.482 kDa

MSRIGKRPITIPNKVTVNIDGSHVAVKGPKGELQRTLPTLVIVEQDEGVLRVVRQDDSRTARQRHGLCRTLVSNMVEGVSKGFEKRLEIQGVGYRAAAQGSKLTLNVGYSKPVEMDMPSGIGVAVEKNTEITITGIDKEIVGNVAAKIRAVRPPEPYKGKGIRYKGEVVRRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.657 kDa

MSRIGKRPIPIPNKVTIDIQGQHVAVKGPKGSLERTLPDKVNVVQENDTLLVQREDDSRTARERHGLTRTLVANMVEGVSKGFEKRLSIQGVGYRAQVQGTKLTLNVGYSKPVEMTMPAGIQVAVENNTLVIVSGIDKEIVGNVSAEIRAVRPPEVYKGKGIRYSDEFVRRKAGKTGKK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.454 kDa

MSRIGKQPVPVPAGVDVTIDGQKVSVKGPKGTLDLTVAEPITVSRNDDGAIVVTRPNDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQSPTKFSISGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.725 kDa

MSRIGNRILKVPANTEVVIENNHITVKGKLGELHYSFSSLIKVNLENGEITTVRSNEEKTTKQLHGTTNAIIKNMLIGVSEGYKKEIEIKGVGYKATLKGNEIEVIAGYSHPVTLALPSNLKVELPKPTNIIISGIDKQAVGEFAANLRKIRKPSPYSGKGIMYKDEQIRRKEGKTASK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.444 kDa

MSRIGKQPVPVPAGVDVNIDGQNISVKGSKGTLELTVSEPISVSRNDDGAIVVTRPDDERRNRSLHGLSRTLIANLVTGVTQGYTTKMEIFGVGYRVVAKGSNLEFALGYSHPVLIEAPEGITFAVETPTKFSISGIDKQKVGQISANIRRLRRPDPYKGKGIRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

19.377 kDa

MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK

rplF

50S ribosomal protein L6

179 amino acids

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.