rplE

50S ribosomal protein L5

210 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

23.843 kDa

MSTDAIAHEMPRLKKQYREQIRAAMQEEFGYRNPMLIPGLEKIVVNMGVGDAAHDSKVMDGAIRDITAITGQKPQVTKARKSIAQFKLREGQPIGCHVTLRGDRMWEFADRLLTLALPRIRDFRGLNSNQFDGKGNYTFGLSEQVMFLEIDQDKIVRIRGMDITFVTTAQTNEEGKALLKHLGFPFKAKDDPKKAKTKRGPAYYAKKKKK

rplE

50S ribosomal protein L5

199 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.267 kDa

MTVTTEGRTIEGRPIGARPVPRLKQRYRDEIAPALREQFSYRNVMQIPGVVKVVVNMGVGDAARDAKLIDGAVRDLAAITGQKPAVRRAKKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLVTIALPRIRDFRGLSPKQFDGAGNYTFGVTEQSIFHEIDIDRIDRVRGMDITVVTTATTDDEGRALLRALGFPFREN

rplE

50S ribosomal protein L5

198 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.238 kDa

MAQKKEEAAATPAAPTAARLQTLYHEKVVSALTERFKYDNVMNVPKLKKISINIGVGEAASEPKLLETALQELSQITGQKPQIRKSKKAISNFKLREGQAIGCRVTLRRKAMYEFFDRFVSIAVPRIRDFRGLPDTSFDGRGNYTVGVREQIIFPEIDIDKVPRIQGMDISFVTSATTDEEAFVLLTELGMPFKKKNN

rplE

50S ribosomal protein L5

196 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.133 kDa

MTTTHPALTAGRPAGYVPRLKQYYREHVVPALREQFGYRNVMQVPTLVKVVVNMGVGEAARDAKLIEGAVRDIAAITGQRPAIARARKSIAQFKLRAGMAIGAYATVRGDRMWEFLDRMLTLALPRIRDFRGLSPKQFDGHGNYTFGLTEQVMFHEVDQDKLDRFRGMDITVVTTARTDDEGRALLRHLGFPFREN

rplE

50S ribosomal protein L5

196 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.364 kDa

MTKKDEKGSNLDIPVSRLAESYKEKVVPALMERFQYKNIMMVPKLTKISINIGVGEAASEPKLLETAMQELAQITGQKPQIRKARKAISNFKLREGQPIGCRVTLRKKYMYEFLDRFVTLAVPRIRDFRGLSNTSFDGRGNYTLGIREQIIFPEIDIDKVPRIQGMDISFVTTARTDEEAFALLSELGMPFKKKNN

rplE

50S ribosomal protein L5

196 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.465 kDa

MAEKKEKVKPTEQQKARLENTYKDKVVPALMERFKYKNIMMVPRLTKISVNIGVGEAAAEPKLLETAIQELSQITGQKPQIRKARKAISNFKLREGQAIGCRVTMRKKYMYEFLERFVTLAVPRIRDFRGLSTTSFDGRGNYSVGVREQIIFPEIDIDKVPRIQGMDISFVTTAKTDEEAFALLSELGMPFRKKNN

rplE

50S ribosomal protein L5

196 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.151 kDa

MPNMSSNIPRMQQRYDESVRAALTETYGYKNVHQVPRLLKISMNMGVGAAVGDKKVLDLAIDSMTQITGQKPVTTIARKSIAGFRLREGMPIGCMVTMRRQRMYEFLDRLVSIVLPRVRDFRGISRKAFDGNGNYTLGLNEQLVFPELNPDKFVRPQGMNISFVTSAKTDDEAREMLRLFGMPFKQPKEKEQAGAA

rplE

50S ribosomal protein L5

195 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.693 kDa

MTDTATSAGKIQPRLKQKYKTEIAANLSKDFGFTNVHQVPGLVKIVVNMGMGEAARDGKVIDGAINDLTLITGQKPQVTKARKSIAQFKLREGQPIGAHVTLRGDRMWEFLDRLLSLALPRIRDFRGLSDKQFDGNGNYTFGLTEQSMFHEINQDRIDRVRGMDITVVTTAKNDEEGRALLKQLGFPFRSVEAAS

rplE

50S ribosomal protein L5

195 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.051 kDa

MDKNKEMTPTTPSLARLETFFKEKVTPNLVERFQYKNAMLVPKLKKISINIGVGAAAAEPKLLEIALQELAQITGQKPQIRKSKKAISNFKLREGQAIGCRVTLRRKAMYEFFDRFVSLAVPRIRDFRGLSDTSFDGRGNYTVGVREQIIFPEIDIDKVPRISGMDISFVTSASTDEEAYVLLSELGMPFKKKNN

rplE

50S ribosomal protein L5

195 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.263 kDa

MTKTKEKAPAENVEARLEIFYKDKVVPKLMERFQYKNVMMVPKLQKIAINIGVGEAAAEPKLLETAMSELAQITGQKPQIRKSRKAISNFKLRENQPIGCRVTLRRKTMYEFLDRFVSLAVPRIRDFRGLNDTSFDGRGNYTTGIREQIIFPEIDIDKVPRISGMDISFVTSAATDEEAYVLLAELGMPFKKKNN

rplE

50S ribosomal protein L5

195 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.287 kDa

MTRKKDETPAEKVEARLESFYREKVVPVMMERFQYSNVMMVPKLEKISINIGVGEAAAEPKLLETAMLELGQITGQKPQVRKSRKAISNFKLRENQAIGCRVTLRRKKMYEFLDRFVSLAVPRIRDFRGLSNTSFDGRGNYTAGIREQIIFPEIDIDKVPRICGMDISFVTSAATDEEAYVLLAELGMPFKKKNN

rplE

50S ribosomal protein L5

195 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.866 kDa

MSGNNESASYASSLARLDTYYREKVVPALMERFQYKNIMEVPRLQKIAINIGVGDAAGEPKLLDVAVGELTQIAGQKPQIRKSKKAISNFKLREGQAIGCRVTLRRKAMYEFFDRFVSLAVPRIRDFRGLSDTSFDGRGNYTAGVKEQIIFPEIDIDKVPRISGMDISFVTSAKSDEEAYVLLSELGMPFKKKNN

rplE

50S ribosomal protein L5

194 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.765 kDa

MTVTTEDRTTGARPVPRLKQRYREEIAATLREEFSYRNVMQIPGVVKVVVNMGVGDAARDAKLIDGAVRDLAAITGQKPAVRRAKKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLVSIALPRIRDFRGLSPKQFDGAGNYTFGVTEQSIFHEIDIDRIDRVRGMDITVVTTATTDDEGRALLRALGFPFREN

rplE

50S ribosomal protein L5

194 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.973 kDa

MAQKTETAIPSNSKARFETLYREKVTKALSERFGYKNVMNIPRLQKISINIGVGEAASEPKLLETAIQELAQITGQKPQIRKSKKAISNFKLREGQAIGCRVTLRRKAMYEFFDRFVSLAVPRIRDFRGLSDTSFDGRGNYTIGVREQIIFPEIDIDKIPKICGMDISFVTSAKTDEEAYVLLAELGMPFKKKN

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.559 kDa

MTETLETPASKIVPRLKTKYADSIKSTLIEEFKYENVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTLITGQKPQVTKARKSIAQFKLREGMPIGAHATLRGDRMWEFLDRLVTLALPRIRDFRGLSGKQFDGNGNYTFGLTEQVMFHEIDQDSIDRVRGMDITVVTTAKTDDEGRALLKALGFPFKTEA

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.952 kDa

MSDNYTPRLKAQYREEIREKLQAEFNFDNVMQIPGVTKVVVNMGVGDAARDSKMINGAIADLTAITGQKPQVRTAKKAIANFKLREGMPIGARVTLRGDRMWEFLDRLLTIALPRIRDFRGLSDRQFDGHGNYTFGLSEQTMFYEIDVDKMDRPRGMNITVVTTATNDEEGRALLRRLGFPFKDKDGKMQQAD

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.593 kDa

MSIETSEATVKIAPRLKTRYADEIKKTLQDDFSYVNVNQVPRLVKVVVNMGVGEAARDSKVIDGAVRDLTLITGQKPMVTKARKSIAQFKLREGMPIGAHTTLRGDRMWEFVDRLVTLALPRIRDFRGLSGKQFDGNGNYTFGLTEQVMFHEIDQDAIDKIRGMDITVVTTAKTDDEGRALLKALGFPFKSED

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.797 kDa

MADKYTPRLKGKYDAEIAAAMQAKFGYKNALEIPRIEKITLNMGVGEASQDKKKVTTAAAEMELIAGQKPVITKAKKSIAQFKLREGMPIGCKVTLRRERMYEFLDRLITIAMPRIRDFRGLNPKSFDGRGNYAMGLKEQIIFPEISYDQIEKVRGMDIIVTTTAKTDDEARELLRLFGFPFPQDAAEQQQAA

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.6 kDa

MTETLETPATKIVPRLKTKYAESIKATLQDEFKYENVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTQITGQKPQVTKARKSIAQFKLREGMPIGAHATLRGDRMWEFVDRLVSLALPRIRDFRGLSGKQFDGNGNYTFGLTEQVMFHEIDQDKIDRVRGMDITVVTTAKTDDEGRALLKALGFPFKTEA

rplE

50S ribosomal protein L5

193 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.945 kDa

MADAYTPRFRKLYDETIVKAMTEKFGYKNHMEVPKITKIVLNMGVGEATQDKKKVEQAALEMTKIAGQKAVITKAKKSIAQFKLREGMPIGAKVTLRRERMYEFLDRFVTIALPRVRDFRGLNPKSFDGRGNYATGLKEQLIFPEISYDSVDKIRGMDVIVATTAKTDDEARELLRLFGFPFPADNEDQKQAA

rplE

50S ribosomal protein L5

192 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.499 kDa

MTETLETPVKIVPRLKTKYAETIKKSLQDEFSYANVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTLITGQKPQVTKARKSIAQFKLREGMPIGAHATLRGDRMWEFVDRLVSLALPRIRDFRGLNGKQFDGNGNYTFGLTEQVMFHEIDQDSIDRVRGMDITVVTTAKTDDEGRALLKALGFPFKTEN

rplE

50S ribosomal protein L5

192 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.74 kDa

MAKAYVPRLKKQYDDEIIKAMTEKFGYKNAFEVPKLTKIVLNMGVGEATQDKKKVDQAAAEMELIAGQKPVVTRAKKSIAQFKLREGMPIGVKVTLRRERMFEFLDRFLTIALPRVRDFRGLNPKSFDGRGNYATGIKEQLIFPEISYDQVSTIRGMDVVVATTAKTDEEARELLRLFGFPFPADTTQKKAA

rplE

50S ribosomal protein L5

192 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.639 kDa

MAKAQSKQATATNTPRLKQVYNETIRKALQEQFGYDNDMQVPRLDKIVLNMGVGEATADSKKPSVAAEDLALIAGQKAVVTRARNSIAGFKVRENMPIGAKVTLRKERMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDVIVCTTAKTDDEARALLKAFNFPFRQ

rplE

50S ribosomal protein L5

192 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.908 kDa

MADNYTPRMKKLYDDKIVKAMTDKFGYKNAMEVPKIEKITLNMGVGEATQDKKKVEAAAAEMELIAGQKPVVTKAKKSIAQFKLREGMPIGCKVTLRRERMYEFLDRLITIAMPRIRDFRGVSAKSFDGRGNYAMGLKEQIIFPEINYDRIDQVRGMDVIVTTTARTDEEARELLRLFGFPFPIEAQEKEAA

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.789 kDa

MTENYIPRLKTRYQDEIRTKLQGEFEFENVMQIPGVTKIVVNMGVGDAARDSKLINGAIEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEFLDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVTTAVTDDEGRSLLRELGFPFKGEDGNRQQ

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.789 kDa

MTENYIPRLKTRYQDEIRTKLQGEFEFENVMQIPGVTKIVVNMGVGDAARDSKLINGAIEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEFLDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVTTAVTDDEGRSLLRELGFPFKGEDGNRQQ

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.505 kDa

MTEVQQTEKVTPRLKTKYREEIRGALQEQFQYGNVMQVPGLVKVVVNMGVGEAAKDSKIIDGAVTDLTAITGQKPMITKARKSIAQFKLREGMPIGTHATLRGDRMWEFLDRLVTLALPRIRDFRGLSDRQFDGNGNYTFGLSEQTVFHEIDQDKIDRVRGMDITVVTTAKNDDEGRALLKALGFPFKTDQ

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.674 kDa

MTEVQQTEKVTPRLKTKYREEIRGRLQEQFQYGNVMQVPGLVKVVVNMGVGEAAKDSKIIDDAVTDLTAITGQKPMITKARKSIAQFKLREGMPIGTHATLRGDRMWEFLDRLVTLPLPRIRDFRGLSDRQFDGNGNYTFGLSEQTVFHEIDQDKIDRVRGMDITVVTTAKNDDEGRALLKALGFPFKTDQ

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.786 kDa

MADVPRLQKQYQDEVRPSLTDQFGYENPMEVPRLEKICVNRGVGEVSENQKALDQAVEEMRKITGQHPTIRRAKRSIASFDVREGMPVGVKVTLREARMYEFFDRLVTLALPNIRDFRGVPDRSFDGRGNYTLGIDEQIIFPEIDVDNVDRIDGMDITFVTDAETDEESYALLKGLGMPFVRRGDEEPAEA

rplE

50S ribosomal protein L5

191 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.46 kDa

MTVTNEIDAPPIPRLKQKYREEIIPALREEFGYTNIMQVPGLTKIVVNMGVGDAARDAKLIQGAIADLSAITGQKPKINRAKKSIAQFKLRQGQPIGASVTLRGDRMWEFLDRLLTLALPRIRDFRGLSAKQFDGNGNYTFGLTEQVMFHEIDPDKVDRQRGMDITIVTTAATDEEGRSLLRRLGFPFKED

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.562 kDa

MAENYTPRLKSRYQDEIRPNLQTQFEFSNVMQIPGVTKVVVNMGVGDAARDSKMINGALEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEFLDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVTTAVTDDEGRALLRELGFPFKGEDGKKQ

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.492 kDa

MTDTTVEAPATPRLKQKYNEQIVPELEKEFHYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGERMWEFLDRLLTMALPRIRDFRGINGDQFDGQGNYNFGLTEQSMFHEIDPDSIDHQRGMDITVVTSTKDDKEARVLLKHLGFPFKEN

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.408 kDa

MTDTTVEAPATPRLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGDRMWEFLDRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDSIDHVRGMDITVVTSTKDDKEAYALLKHLGFPFKEN

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.408 kDa

MTDTTVEAPATPRLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGDRMWEFLDRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDSIDHVRGMDITVVTSTKDDKEAYALLKHLGFPFKEN

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.408 kDa

MTDTTVEAPATPRLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGDRMWEFLDRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDSIDHVRGMDITVVTSTKDDKEAYALLKHLGFPFKEN

rplE

50S ribosomal protein L5

190 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

22.194 kDa

MAKLRDYYKSHVVYDLMREFKYKSVMQVPKINKITISMGVGKSIINKKFLERAIEDLEMISGQKPVITKARKSIASFKIRQGQEIGCKVTLRRKRMWEFFERLISIAIPRIRDFRGLSIKSFDGYGNYTMGIREQIIFPEINYDTIDGIRGMNITITTNAVSDKEAYVLLRAFRFPLKNNDSIYTSTEEH

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.506 kDa

MSENYTPRLKTRYREEIREKLNGEFSYENVMQIPGVTKVVVNMGVGDAARDSKLINGAIEDLTKITGQKPQIRTAKKAIANFKLREGMPIGARVTLRGDRMWEFLDRLLTVALPRIRDFRGLNDKQFDGHGNYTFGLSEQSMFYEIDVDKIDRPRGMNITVVTTATNDDEGRALLRELGFPFKQKGSAE

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.39 kDa

MTTATETKTMPRLKERYRNEIVGQLREQYKYGNPMQVPGLVKIVVNMGVGEAARDAKLIDGAVRDLATITGQKPQVRRATKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLLSIALPRIRDFRGLDGRKLDGNGNYTFGLTEQSVFHEIDQDKIDRQRGMDITVVTTATTDDEGRALLKFLGFPFKEN

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.39 kDa

MTTATETKTMPRLKERYRNEIVGQLREQYQYGNPMQVPGLVKIVVNMGVGEAARDAKLIDGAVRDLATITGQKPQVRRATKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLLSIALPRIRDFRGLDGRKLDGNGNYTFGLTEQSVFHEIDQDKIDRQRGMDITVVTTATTDDEGRALLKFLGFPFKEN

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.128 kDa

MSVTTEARPVPRLKQRYREEIAPALREEFSYGNVMQIPGVVKVVVNMGVGDAARDAKLIDGATRDLAAITGQKPAVRRAKKSIAQFKLREGQPIGAKVTLRGDRMWEFLDRLVTIALPRIRDFRGLSPKQFDGAGNYTFGVIEQSIFHEIDIDRIDRVRGMDITVVTTATNDDEGRALLRALGFPFRES

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.357 kDa

MTTTTEARALPRLKQRYRDEIKGQLHEQFSYGNVMQIPGLTKVVVNMGVGEAARDSKLIDGAVRDLTAITGQKPQITKARKSIAQFKLREGMPIGCHTTLRGDRMWEFLDRLLSLALPRIRDFRGLSPKQFDGNGNYTFGLNEQSMFHEIDQDKIDRVRGMDITVVTTATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

189 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.346 kDa

MSETTETKFTPRFKTKYQETVAPALQEQFGYANVMEMPRVVKVVVNMGLGEAAKDSKLVDNAIKDLTAITGQKPVINRAKKSIAQFKLREGMPIGAHVTMRGDRMWEFLDRLVTLALPRIRDFRGLSDRHFDGNGNYTFGLTEQSMFHEIDQDKIDRVRGMDITVVTSAKTDDEGRALLKALGFPFKTN

rplE

50S ribosomal protein L5

188 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.624 kDa

MSATETKYVPRLYKKYKEEVVPILQKKFNYKSPMQIPRLQKIVVNMGVGEAVQDIRQLERAVEDLRAITGQQPVITRARKSEAGFKLRKGMPIGCKVTLRKERMWDFLDKLISVALPRVKDFKGLSPRSFDGRGNYAFGIAEQIVFPEIDYDKVDRIRGMDIIINTTAETDEEAFWLLSLLGLPIRSM

rplE

50S ribosomal protein L5

188 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.385 kDa

MSATETKYVPRLYKKYKEEVVPKLIQKFQYKNPMQVPRLVKIVVNMGVGEAVQDIKQLERAVEDLRAITGQQPMITRARKSKAGFKLRKGMPIGCKVTLRNHTMWDFLDKVISVALPRVKDFKGLNPRSFDGRGNYAFGIAEQIVFPEIDYDKVDRIRGMDIIINTTAVSDQESLLATLTLGLPIRAM

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.376 kDa

MSENYTPRLKTRYREEIRTKLNDEFSYENVMQIPGVVKVVVNMGVGDAARDSKLINGALEDLTLITGQKPELRRAKKSIANFKLREGMPIGARVTLRGDRMWEFLDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLSEQTMFYEIDVDKIDRPRGMDITVVTTATNNEEGRALLRELGFPFKKADA

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.958 kDa

MSEYKNALPRLHQRYEDVLKKQLREQFGYANELQVPKLEKIVLNMGVGEAAGDQKKLDAAVAEMTVISGQKPVKTLARKAIAGFKIREGLPIGCKVTLRRARMYEFLDRLVTIAMPRIRDFRGLPANKGFDGHGNFAMGIKEQIVFPEIEYDKIDAVRGMDIIFVTSAKSDAEAKALLKAFDLPFNG

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.181 kDa

MTTTEKVQPRLKERYRNEIRDSLQQQFGYANVMQIPTVTKVVVNMGIGEAARDAKLINGAVNDLALITGQRPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.06 kDa

MTTTENAQPRLKTRYREEIKTALNDEFKYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVTDLALITGQKPEIRKARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLVSIALPRIRDFRGLSPKQFDGKGNYTFGLTEQSMFHEIDVDSIDRPRGMDITVVTSATTDDEGRALLRQLGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.019 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.019 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.992 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGSYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.106 kDa

MSVLKDRYENEIKQSLLKDMNLSSTMAIPKIEKIIINMGVTQAVTDKKYVDSAVEELSQIAGQRAVVTRAKKSIANFKLRQGMPIGCRVTLRGERMYDFLERLIFIALPRVRDFQGIPRRGFDGNGNYNLGIKEHTIFPEISFDKTDAVKGLNITIVTTADNDDMARTLLERVGLPFRAAPKSQENK

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.062 kDa

MTTTEKIQPRLKVRYREEIKDALAKEFNYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVEDLALITGQKPQIRKATKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLVSIALPRIRDFRGLSPKQFDGNGNYTFGLSEQSMFHEIDVDKIDRPRGMDITVVTTATNNEEGRALLKHLGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.933 kDa

MLDSANYTPRLKAVYRDTIRAALKEEFGYKNDMQIPRLDKIVLNIGCGAEAVRDSKKAKSAQADLTLIAGQKAMTTTAKKSIAGFRVREEMPLGAKVTLRGDRMYEFLDRLITIAMPRIRDFRGISGKSFDGRGNYAMGLKEHLVFPEIDFDKIDENWGMDIVIATTAQTDAEAKSLLKAFNMPFNS

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.802 kDa

MLDDATYTPRLKTLYKDTIRGALKEEFGYKNEMQIPKLDKIVLNIGCGRAAVKDSKKAKSAQEDLTKIAGQKALTTVAKNSIAGFRVREGMPMGAKVTLRGERMYEFLDRLITIAMPRIRDFRGVSGTSFDGRGNYALGLKEHIVFPEIDFDKIDEAWGMDIVIATTANTDAEAKALLKAFNMPFNS

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.281 kDa

MTTTEKIVPRLKTRYRDEIRQALNEEFHYSNAMQVPGVVKVVVNMGVGDAARDSKLIEGAVRDLATITGQKPEIRKARKSIAQFKLREGMPIGARVTLRGDRMWEFIDRLVTIALPRIRDFRGLSGKQFDGKGNYTFGLNEQSMFHEIDPDSIDRPRGMDITVVTTANTDEEGRVLLRRLGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.722 kDa

MLDAATYTPRLKAAYAETIRAAMKEEFGYKNDMMIPRLDKIVLNIGAGAEAVKDSKKAKSAQDDLSAIAGQRAVITKAKKSIAGFRVREDMPLGAKVTLRGDRMYEFLDRLITIAMPRIRDFRGVKGSAFDGRGNYALGLKEHIVFPEINFDKVDEVWGMDIIICTTAASDAEAKALLKHFNMPFNS

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.068 kDa

MSTAEKVQPRLKQRYRSEIREALNKQFSYGNVMQIPTVVKVVVNMGVGDAARDAKLINGAVSDLALITGQKPEVRKARKSIAQFKLREGMPIGVRVTLRDDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.068 kDa

MSTAEKVQPRLKQRYRSEIREALNKQFSYGNVMQIPTVVKVVVNMGVGDAARDAKLINGAVSDLALITGQKPEVRKARKSIAQFKLREGMPIGVRVTLRDDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.095 kDa

MTTTEKVQPRLKERYRNEIRDSLQQQFGSANVMQIPTVTKVVVNMGIGEAARDAKLINGAVNDLALITGQRPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLTSIALPRIRDFRGLSSKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.203 kDa

MAIKSVLYDKYKKDVTKSLMKEFNYKSTMEIPRLEKIVINSGLGDATSDSKIVEIGLKELHLITGQKPIATKSKKSIATFKLREGQAIGAKVTLRRENMWNFLTKLISIAIPRIRDFRGLSTKSFDGNGNYTFGIKEQIIFPEIVYDDVKKLRGFDITIVTSAKTDKEAMFLLKELGMPFVKTKEAK

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.122 kDa

MTTTEKALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAKLINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDRPRGMDITVVTTATNDAEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.081 kDa

MTTAEKTLPRLKQRYREEIRESLQQQFGYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVNDLALITGQKPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLVAIALPRIRDFRGLNPKQFDGTGNYTFGLTEQSMFHEIDVDSIDRPRGMDITVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.081 kDa

MTTAEKTLPRLKQRYREEIRESLQQQFGYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVNDLALITGQKPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLVAIALPRIRDFRGLNPKQFDGTGNYTFGLTEQSMFHEIDVDSIDRPRGMDITVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.081 kDa

MTTAEKTLPRLKQRYREEIRESLQQQFGYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVNDLALITGQKPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLVAIALPRIRDFRGLNPKQFDGTGNYTFGLTEQSMFHEIDVDSIDRPRGMDITVVTSATTDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.019 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.019 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

187 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.019 kDa

MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.312 kDa

MIEMARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLISITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTNEEAKALLEAFNLPLKDKDRK

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.948 kDa

MLDQATYTPRLKAQFRETIRAALKEEFGYKNDMQIPRLDKIVLNMGIGEAVKDTKKVKQGAEELSLIAGQKAVITKAKKSIAGFRVREEMPLGCKVTLRGDRMYEFLDRLINIALPRVRDFRGVKGSAFDGRGNYAMGLKEHIVFPEINFDKVDEVLGMDIIICTTARTDAEAKSLLKAFNMPFNS

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.967 kDa

MSDTATYTPRLRAKYTETIRAAMKEKFGYANDMMIPRLDKIVINMGVGEASQDSKKIKGALEDLEAITGQKPVKTVAKKSIAGFKLREEQVIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNGKSFDGRGNYAMGMKEHIVFPEIDYDKVEKIRGMDIVVCTTAGNDEEAKALLAEFDFPFTN

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.317 kDa

MADQAYEPRLKTEYRERIRKSLKDRFGYSNEMQIPKLEKIVINMGVGEAVADSKKIQSAMADLAKIAGQKPVSTKARTSIAGFKLREGMTVGCKVTLRKDRMYEFLDRLITIALPRVKDFRGLKPTSFDGRGNYAMGLKEHIVFPEINYDQIDQIWGMDIIVTTTAKTDDEARELLKEFQFPFVQQ

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.884 kDa

MSATANLKKDYQERIVPALMKQFGYTSVMQVPVLKKIVINQGLGMATGDKKIIDVAVSELTAITGQKAVPTVSKKDISNFKLRKKMPIGVMVTLRREQMYEFLERLVRIALPRIRDFKGIESKLDGRGNYTLGINEQIIFPEINIDAITKILGMNITFVTSAQSDEEGYALLKEFGLPFKNAKKQN

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.884 kDa

MSATANLKKDYQERIVPALMKQFGYTSVMQVPVLKKIVINQGLGMATGDKKIIDVAVSELTAITGQKAVPTVSKKDISNFKLRKKMPIGVMVTLRREQMYEFLERLVRIALPRIRDFKGIESKLDGRGNYTLGINEQIIFPEINIDAITKILGMNITFVTSAQSDEEGYALLKEFGLPFKNAKKQN

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.906 kDa

MLDQTNYTPRLKAAYANTVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGEAVKDTKKVKTAAEELSMIAGQKAVVTHAKKSIAGFRVREQMPLGCKVTLRGDRMYEFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIIICTTAKTDAEAKALLKQFNMPFIS

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.892 kDa

MLDQTNYTPRLKAAYANSVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGEAVKDTKKVKTAAEELSMIAGQKAVVTHAKKSIAGFRVREQMPLGCKVTLRGDRMYEFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIIICTTAKTDAEAKALLKQFNMPFIS

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.947 kDa

MLDQTNYTPRLKSLYASNVRAALKEQFSYKNDMQIPRLDKIVLNMGVGEAVKDTKKVKTAAEELSMIAGQKAVITHAKKSIAGFRVRELMPLGCKVTLRGDRMYEFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIIICTTAKTDAEAKALLKQFNMPFVS

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.892 kDa

MLDQTNYTPRLKAAYANSVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGEAVKDTKKVKTAAEELSMIAGQKAVVTHAKKSIAGFRVREQMPLGCKVTLRGDRMYEFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIIICTTAKTDAEAKALLKQFNMPFIS

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.839 kDa

MLDAANYTPRLKAQYAETIRAALKEEFGYKNDMMIPKLEKIVLNIGCGAEAVKDSKKAKSAQEDLSKIAGQKAITTTAKKSIAGFRVREDMPMGAKVTLRGERMYEFLDRLITIAMPRIRDFRGVKPSFDGRGNFAMGIKEHIVFPEIDFDKVDEVWGMDIVIATTAKTDAEAKSLLKHFNMPFNA

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.515 kDa

MNYCPRPKYLYKKKIINKLIEKFNYKSVMQVPKLKKIVINQGINVLIYDNKTINNAINNITAITGQKAIYCLSKRDESGFKLRKGTPISIKVTLRRDIMYEFLDRLINIALPRVRDFVGVNKNSFDGEGNYNLGISEQIIFPEINTDSLKNNFGMNITFVTSSKKNKEAKYLLYLFGLPFKTKKNV

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.314 kDa

MLKQKYKSEVVSALVKEFQYSSVMEVPRIEKIVVNMTAGKEVNNSKAIEEVLNELTLITGQKPYQTVAKKSNAAWKLRKNMPMGGKVTLRKDRMWDFLEKLITVAMPRIRDFRGANHKAFDKNGNFALGIKEEIIFPEIEFDKIRRNKGLDVIVVTTAKTAKESKRLLELLGMPFDDKKHTKESAK

rplE

50S ribosomal protein L5

186 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.752 kDa

MLDTANYTPRLKAAFSETIKAAMKEEFGYKNDMQIPRLEKIVLNIGSGAESVRDTKKAKSAQEDLTAIAGQHAVVTKAKKSIAGFRLREEHPVGAKVTLRGDRMYDFLDRLTTIAMPRIRDFRGVKPSFDGRGNFAMGMKEHIVFPEINFDKIDVAWGMDIIIVTTANTDAEAKSLLAHFNMPFNA

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.804 kDa

MAETAYIPRLREVYDRDIRSKLTEQFGLTNVMQVPRLDKVVINMGVGEAVNDRKKVELAAGDLALIAGQKPIVTHSRKAIATFKLREGQAIGAKVTLRKAKMYEFIDRLINVALPRVRDFRGLNPKSFDGRGNYSLGLKEHIVFPEIDYDKSGESWGMDITVCTTAATDEQARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.874 kDa

MSNTASLKKEYQDRIVPALTKEFGYKSVMQVPVLKKIVINQGLGMATADKKIIDIAISELSTITGQKAVATVSKKDISNFKLRKKMPIGVMVTLRREQMYEFLERLVRVALPRIRDFKGIESKLDGRGNYTLGIQEQIIFPEINIDNITKILGMNITFVTSAKTDEEGYALLREFGLPFKNGKKD

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.254 kDa

MAEAQYIPRLKVQYLEKFRPELTEKFSYKNLLEVPRLDKIVLNMGVGEAVGDSKKIKSAFEDLQAIAGQKPVITKAKTSIATFKLREGMPIGVKVTLRKDRMYEFLDRLVTVALPRVRDFRGLNAKSFDGRGNYAMGLKEHIVFPEIDYDKVDQIWGMDIIVCTTAKTDDEARELLRKFNFPFTK

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.998 kDa

MSRLKKRYLADVKPELQKKFAYKNLMQVPGLVKVVINMGIAEASKDKNSIQDCVKEMTMLSGQKPVITKAKKAISNFKLREDQPIGVKVTLRGQRMFDFIDRFVNIVCPRIRDFRGFPSKCDGMGNYTLGLDDQQIFPEINLDEVKRTQGMHITFVTSAKTDEECVELLRLLGIPFKNLPISVAA

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.898 kDa

MTATTAPRLKTRYREEIAGKLREEFSYENVMQVPGLVKIVVNMGVGDAARDSKLIDGAVKDLTTITGQKPAVTKARKSIAQFKLREGQPIGCHVTLRGDRMWEFLDRTLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQVMFHEIDQDKIDRVRGMDITVVTTATNDDEGRALLRHLGFPFKEN

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.066 kDa

MAEATYTPRLRTHYDSVVRPKLIEEFGYKNPMQVPVIEKIVINMGVGEATADTKKVTTAAADLARIAGQKPVLTRARKAISNFKLRENQPVGAKVTLRQARMYEFMDRLITVALPRVRDFRGLNPKSFDGRGNYAMGMKEHIVFPEINYDQVEQIWGMDIIVCTTAKTDDEARALLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.847 kDa

MADLKQVYHDKVVPELQAKFGYSNVMQVPRLQKIVVNMGVGEAIADKNFLNNAIGNLEAITGQKAQTTYAKKSIAGFKLREGQAVGCRVTLRRRQMWEFLDRLINAALPRVRDFRGVSEKAFDGRGNYTMGIKEQIIFPEIDYDKVDKVRGMDICIVTSAKTDDEARQLLAGFNMPFRKKEGNNG

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.951 kDa

MAEAKYEPRLKKEYVERIRKAMQEKFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITRARNSIAGFKVRENMPIGAKVTLRGARMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATTDDEARALLKEFSFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.804 kDa

MTDHSCIPELKVRYVQQIVPDMMRDFGYSTVMQVPKLLKIVLSMGLGEALANRKLLDASVADLGVISGQHAVKTRARKSIANFKLREGNEIGVMVTLRRSRMYEFLHRLINVALPRVKDFRGVSPXGFDGHGNYSMGITEQIIFPEIDFDKIERISGLNVNVVTSAQTDQEARTLLTKLGMPFRK

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.804 kDa

MTDHSCIPELKVRYVQQIVPDMMRDFGYSTVMQVPKLLKIVLSMGLGEALANRKLLDASVADLGVISGQHAVKTRARKSIANFKLREGNEIGVMVTLRRSRMYEFLHRLINVALPRVKDFRGVSPXGFDGHGNYSMGITEQIIFPEIDFDKIERISGLNVNVVTSAQTDQEARTLLTKLGMPFRK

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.894 kDa

MSNTASLKKEYAERIAPALKSQFQYSSTMQIPVLKKIVINQGLGMAVADKKIIEVAINEMTAITGQKAVATISRKDIANFKLRKKMPIGVMVTLRRERMYEFLEKLVRVALPRIRDFKGIETKFDGKGNYTLGIQEQIIFPEINIDSITRILGMNITFVTSAQTDEEGYALLKEFGLPFKNAKKD

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.894 kDa

MSNTASLKKEYAERIAPALKSQFQYSSTMQIPVLKKIVINQGLGMAVADKKIIEVAINEMTAITGQKAVATISRKDIANFKLRKKMPIGVMVTLRRERMYEFLEKLVRVALPRIRDFKGIETKFDGKGNYTLGIQEQIIFPEINIDSITRILGMNITFVTSAQTDEEGYALLKEFGLPFKNAKKD

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.797 kDa

MNLKTKYKTKIVPLLQKEFGFSSVMQVPKIEKIVINMGVGDATKDAKLLELAQAELQAISGQKPVITKAHSSNASFKIRQGQAIGCKVTLRGEKMWNFLEKLINIALPRVRDFRGLSNRAFDARGNYTLGIKEQIIFPEIIYDNVKKIRGFDVTLVISSDNAKYNHRLLLELGMPLIKTKEHANG

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.917 kDa

MAEAAYTPRLRAEYDAKIRTAMTEKFGYENVMQVPRLDKVVLNMGVGDSVNDRKKAETAAAELTQIAGQKAIVTYSRIAIATFKLRENQPIGCKVTLRKARMYEFIDRLVTVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKVTEARGMDITVCTTAKTDEEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.787 kDa

MAETAYTPRLRTEYDRKIKSALTEKFGYANVMQVPRLDKVVLNMGIGEAVNDRKKAETAAADLSLIAGQKAVVTYSRVAIATFKLRENQPIGCKVTLRKAKMYEFIDRLINVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKAGESWGMDITVCTTAATDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.817 kDa

MAETAYTPRLRTEYDRKIKSALTEKFGYANVMQVPRLDKVVLNMGIGEAVNDRKKAETAAADLSLIAGQKAVVTYSRVAIATFKLRENQPIGCKVTLRKAKMYEFIDRLINVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKAGESWGMDITVCTTATTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.802 kDa

MAETAYVPRLRVEYDKSIRTKLTEQFGYVNVMEVPRLDKVVLNMGIGEAVNDRKKAETAAGDLSLIAGQKALVTYSRVAISTFKLRENQPIGCKVTLRKAKMYEFIDRLINVALPRVRDFRGLNPKSFDGGGNYSLGIKEHIIFPEIDFDKAGESWGMDVTVCTTAQTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.886 kDa

MAETAYVPRLRAEYDKSIRSRLTEQFGYVNVMQVPRLDKVVLNMGIGEAVNDRKKAEAAAGDLSLIAGQKAVVTYSRVAISTFKLRENQPIGCKVTLRKTKMYEFIDRLVNVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKVGESWGMDVTVCTTAQTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.104 kDa

MAEAKALPRFKKLYNENIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLGLIAGQKAVITRARNSIATFKLREGMPIGTKVTLRQDRMYEFLDRFITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARALLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.797 kDa

MATTTTPRLKTKYREEIAGKLQEEFSYENVMQTPGLVKIVVNMGVGDAARDSKLIDGAIRDLTTITGQKPAVTKARKSIAQFKLREGQPIGAHVTLRGDRMWEFLDRTLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQVMFHEIDQDKIDRVRGMDITVVTTATNDAEGRALLRHLGFPFKEA

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.853 kDa

MATTTTPRLKTKYREEIAGKLREEFSYENVMQIPGLVKIVVNMGVGDAARDSKLIEGAIRDLTTITGQKPAVTKARKSIAQFKLREGQPIGAHVTLRGDRMWEFLDRTLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQVMFHEIDQDKIDRTRGMDITVVTTATNDAEGRALLRHLGFPFKEA

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.981 kDa

MAEAKYEPRLKKEYVERIRKAMQEKFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITRARNSIAGFKVRENMPIGAKVTLRGARMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATTDDEARTLLKEFSFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.965 kDa

MAEAKYEPRLKKEYVERIRKALQEQFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITRARNSIAGFKVREQMPIGAKVTLRGARMYEFMDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATTDDEARALLKEFSFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.981 kDa

MAEAKYEPRLKKEYVERIRKAMQEQFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITRARNSIAGFKVREQMPIGAKVTLRGARMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFLEINYDKVDQMWGMDIIVCTTATTDDEARALLKEFSFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.935 kDa

MAKSAYESRLKKEYVERIRKAMQEQFSYANEMQIPRLDKIVINMGVGEATGDSKKPTVAAADLAAIAGQKPVITRARNSIAGFKLREGMPIGAKVTLRGVRMYDFLDRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATNDDEARALLKEFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.791 kDa

MAETAYVPRLRAEYDNSIRTQLTEKFGYGNVMQVPRLDKVVLNMGVGEAVNDRKKAEQAAADMALIAGQKAVVTYSRVAISTFKLRENQPIGCKVTLRKAKMYEFIDRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKTGESWGMDITVCTTAGTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.977 kDa

MSETAYTPRLRAEYDQSIRSKLTEEFGYANVMQVPRLDKVVLNMGVGEAVNDRKKAEQAAADLGLIAGQKPIITFSRMAISTFKLRENQPIGCKVTLRKAKMYEFIDRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKMGETWGMDITVCTTAKTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.038 kDa

MAETAYVPRLRTEYDRHIRTQLTEKFGYANVMQVPKLDKVVLNMGVGEAVNDRKKAEQAAADLSLIAGQKAVITYSRVAISTFKLRENQPIGCKVTLRQARMYEFIDRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKTGESWGMDITVCTTARTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.989 kDa

MAETAYVPRLREQFDREIRGKLTEQFGYANVMQVPRLDKVVLNMGIGEAVNDRKKAETAAADLALIAGQKPIVTYSRVAIATFKLRENQPIGAKVTLRKAKMYEFIDRLINVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKMGETWGMDVTVCTTARTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.974 kDa

MAETAYVPRLRTEYDKSIRTQLTEKFGYGNVMQVPRLDKVVLNMGIGEAVNDRKKAEQAAADMALIAGQKPIITYSRVAISTFKLRENQPIGCKVTLRKAKMYEFIDRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKSGESWGMDITVCTTARSDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.038 kDa

MAETAYVPRLRTEYDRHIRTQLTEKFGYANVMQVPKLDKVVLNMGVGEAVNDRKKAEQAAADLSLIAGQKAVITYSRVAISTFKLRENQPIGCKVTLRQARMYEFIDRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKTGESWGMDITVCTTARTDDEARALLTAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.036 kDa

MAEATYTPKLRTFYDEVVRPKMIEQFGYKNPMEVPTIDKIVINMGVGEATADTKKVTTAAADLAQIAGQKPVITRARKAISNFKLRENQPVGAKVTLRKARMYEFMDRLVSIALPRVRDFRGLNPKSFDGRGNYAMGVKEHIVFPEINYDRVEQIWGMDIIVCTTAKTDEEARALLKAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.957 kDa

MVDQAYEPRLKSEYRARIRAAMKEQFAYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLMAIAGQKPVATKARKSIAGFKLREGMVVGAKVTLRKDKMYEFLDRLVTIALPRVKDFRGLNGKSFDGRGNYAMGLKEHLVFPEINYDQIEQIWGMDIIVCTTAKTDQEAKALLKEFQFPFTN

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.965 kDa

MADQAYEPRLKTVYRERIRAAMKEQFGYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLQAIAGQKPVATKARKSIAGFKLREGMVVGAKVTLRKDRMYEFLDRLVTIALPRVKDFRGLNGKSFDGRGNYAMGLKEHLVFPEINYDQIEQIWGMDIIVCTTAKSDQEAKALLKEFQFPFVN

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.965 kDa

MADQAYEPRLKTVYRERIRAAMKEQFGYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLQAIAGQKPVATKARKSIAGFKLREGMVVGAKVTLRKDRMYEFLDRLVTIALPRVKDFRGLNGKSFDGRGNYAMGLKEHLVFPEINYDQIEQIWGMDIIVCTTAKSDQEAKALLKEFQFPFVN

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.946 kDa

MAKAGYQPRLKKHYEEAIRKQLLETFKYENEMQVPRIDKVVINMGVGEATGDSKKPSVAAEDLALIAGQKAVITRARNSIAGFKVREGMPIGAKVTLRKDRMYEFLDRLVNVALPRVRDFRGLSPKSFDGHGNFAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARALLKAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.853 kDa

MSNTASLKKEYADRIAPALKSQFQYSSTMQVPVLKKIVINQGLGMAVADKKIIEVAINEMTAITGQKAVATISRKDIANFKLRKKMPIGVMVTLRRERMYEFLEKLVRVALPRIRDFKGIESKFDGKGNYTLGIQEQIIFPEINIDSITRILGMNITFVTSAETDEEGYALLKEFGLPFKNAKKD

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.86 kDa

MSNTASLKKEYAERIAPALKNQFQYSSTMQIPVLKKIVINQGLGMAVADKKIIEVAINELTAITGQKAVATVSRKDIANFKLRKKMPIGVMVTLRRERMYEFLEKLVRVALPRIRDFKGIESKFDGRGNYTLGIQEQIIFPEINIDSITKILGMNITFVTSAPTDEEGYALLKEFGLPFKNSKKD

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.011 kDa

MAEEKQKPRMKVHYVGVIRKILQEKFHYKNEMQIPRVDKIVINMGIGEATSDSKKPSIAAGDLSLITGQKAVVTYASSSIAGFKVREGMPLGAKVTLRKDRMFEFLDRLVTIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARELLRAFNFPFRS

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.186 kDa

MAEEKQTPRMKTHYFEVVRKTLQEKFNYKNVMQIPRVDKIVINMGIGEATADSKKPSIAAEDLGLITGQKAVVTRARNSIATFKVREGMPLGAKVTLRKDRMFEFLDRLVTIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARELLRAFNFPFRS

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.233 kDa

MAEEKQTPRMKTRYFEVIRKTLQEKFNYKNAMQIPRVDKVVVNMGIGEATIDSKRPSLAAEDLGLITGQKAVVTRARNSIATFKVREGMPLGAKVTLRKDRMFEFLDRLVTIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARELLRAFNFPFRS

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.196 kDa

MAEERQIPRMKTHYFEVIRKALQEKFNYKNAMQIPRIDKIVINMGIGEATADSKKPSLAAEDLGLITGQKAVVTRARNSIATFKVREGMPLGAKVTLRKDRMFEFLDRLVTIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARELLRAFNFPFRS

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.851 kDa

MAEVKYEPRLKKEYVARIRAALQEKFSYANEMQIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITHARNSIAGFKVRENMPIGAKVTLRGARMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATTDDEARALLKEFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.945 kDa

MAETKYEPRLKAEYVSRIRQALREQFSYANEMQIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITRARNSIAGFKVREDMPIGAKVTLRGARMYEFMDRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTAPTDDEARALLKEFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.888 kDa

MAKTAYEPRLKKEYVERIRKAMQEKFSYANEMQIPRLDKIVINMGVGEATGDSKKPSVAAADLAAIAGQKPVITRARNSIAGFKLREGMPIGAKVTLRGVRMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATNDDEARALLAEFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.941 kDa

MAKSAYEPRLKKEYVERIRKAIQEQFSYANEMQIPRLDKIVINMGVGEATGDSKKPTVAAADLAAIAGQKPVITRARNSIAGFKLREGMPIGAKVTLRGVRMYEFLDRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATNDDEARALLKEFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.108 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSFLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

185 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.074 kDa

MAEAKALPRFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFLDRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTAKTDDEARSLLRAFNFPFRQ

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.605 kDa

MGARLKEVYSTEIAPALVKRLQLKNVMEVPRVEKVVLNMGLGEAIQNIKVLESAVEELTRICGQKPVVTKAKKSIAQFKLREGMPIGCMVTLRRDKAYEFLDRLINVALPRVRDFKGVSKKGFDGRGNYTLGIREQLIFPEIDLEKVDKVKGLNVTIVTTAKNDEEGYALMEAIGMPFPKKAQD

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.931 kDa

MIPRLKELYYKEIQPQLKETLGYKNTYMGPKVEKVVINMGLGLDGADAKIMKSTEEDLGKITGQKPTVTKFKKSVANFKTRKGTNAGLKVTLRGNKMYEFLDRLVNIALPRIKDFRGLSPKGFDKFGNYTFGIKEHIIFPEVNFDRIDKIRGLDIVVVISALNKDHSFALLEKLNFPFIKKGDN

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.016 kDa

MSENYTPRLKTRYRSEIRETLNKEFEYANVMQIPGVTKVVVNMGVGDAARDSKLINGALNDLTLITGQKPQIRRAKKAIANFKLREGMPIGARVTLRGDRMWEFLDRLLTVALPRIRDFRGLSDKQFDGHGNYTFGLSEQSMFYELDVDKIDRPRGMNITVVTSATNNEEGRALLRELGFPFKK

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.339 kDa

MAFLKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETKAKKSIATFKLRAGQSIGAKVTLRGDRMWAFIETLFNIALPRVRDFKGISNNSFDNQGNYTLGIKEQIIFPQVVYDDVKSVRGFDVTFVTTAKTAQEAKALLVGLGAPFQKVRGDK

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.339 kDa

MAFLKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETKAKKSIATFKLRAGQSIGAKVTLRGDRMWAFIETLFNIALPRVRDFKGISNNSFDNQGNYTLGIKEQIIFPQVVYDDVKSVRGFDVTFVTTAKTAQEAKALLVGLGAPFQKVRGDK

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.34 kDa

MAFLKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETKAKKSIATFKLRAGQSIGAKVTLRGDRMWAFIETLFNIALPRVRDFKGISNNSFDDQGNYTLGIKEQIIFPQVVYDDVKSVRGFDVTFVTTAKTAQEAKALLVGLGAPFQKVRGDK

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.957 kDa

MAYEFVPLKEKYQKEVVPVLMKEFGYKNIHEVPRLVKVVINMGVGEGSRNKDVIEAHARELTTIAGQKAIITKAKKSISNFKIRKGMSVGVKVTLRGPRMYNFVYKLVNLVLPKVRDFRGLNPNSFDGKGNYSFGLTEQLVFPEISPDQIKRIQGMDIVVVTTAKRDEEARRLLELLGFPFKKQ

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.537 kDa

MYQLKKLYNEELKAKLSEELGIKNPMLLPKLEKIVISVGAGDHAKDTKVMQNIADTISLIAGQKAVITIAKKSVAGFKMREGMPMGVKVTLRGNQMYNFLEKLISIALPRVKDFRGVPRNGFDGRGNYSFGLNEQLMFPEVVYDDIMVSHGMNITMVTTTNNDKEAFKMLELFGMPFAKGRVNG

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.306 kDa

MRYEYVPLKDQYEKEIVPALMKEFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTRARKSISNFKIRKGMPIGLKVTLRGARMYNFLYKLINIVLPKVRDFRGLDPNSFDGRGNYSFGLSEQLVFPELNPDEVRRIQGMDITIVTTAKTDQEARRLLELFGMPFKRG

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.279 kDa

MRYEYVPLKDQYEKEIVPALMKEFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTRARKSISNFKIRKGMPIGLKVTLRGARMYNFLYKLINIVLPKVRDFRGLDPNSFDGRGNYSFGLSEQLVFPELSPDEVRRIQGMDITIVTTAKTDQEARRLLELFGMPFKRG

rplE

50S ribosomal protein L5

184 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.758 kDa

MADKYEPRLKTEYVSRIRGAMQEKFSYANVMMIPKLDKIVINMGVGEATADSKKPTIAAGDLAAIAGQKPVITKARNSIAGFKVREHMPIGAKVTLRGERMYEFLDRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTATSDDEARALLTEFNFPFRH

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.009 kDa

MSENYTPRLKTRYREEIKKALNEEFKYENVMQIPGVTKVVVNMGVGDAARDSKMINGALEDLTAITGQKPQVRRAKKSIANFKLREGMPIGARVTLRGDRMWEFLDRLLTIALPRIRDFRGLSDQQFDGHGNYTFGLSEQTMFYEIDIDKVDRPRGMDITVVTSATNDEEGRKLLRELGFPFK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.939 kDa

MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLISITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTNEEAKALLEAFNLPLKDKDRK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.939 kDa

MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLISITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTNEEAKALLEAFNLPLKDKDRK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.939 kDa

MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLISITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTNEEAKALLEAFNLPLKDKDRK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.83 kDa

MVPRLKSKYEKEIRPTLQKSLGFQSVMRVPKLEKIVINVGMGEAHTNPKAMEACLVEIGQITGQRPVKTFAKKSIAGFKVREGMVLGCKVTLRGHHMYEFLDRFINVALPRVRDFRGVNPKGFDGRGNYNLSVREQIIFPEIQFDKINTIYGINITFVTNTEVDKEAFELFQAFGMPYRTAGK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.83 kDa

MVPRLKSKYEKEIRPTLQKSLGFQSVMRVPKLEKIVINVGMGEAHTNPKAMEACLVEIGQITGQRPVKTFAKKSIAGFKVREGMVLGCKVTLRGHHMYEFLDRFINVALPRVRDFRGVNPKGFDGRGNYNLSVREQIIFPEIQFDKINTIYGINITFVTNTEVDKEAFELFQAFGMPYRTAGK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.623 kDa

MSNYVPRLKKVYTEQIMPELKKEFNYSSVMQIPRLKKVVVSMGVGVALTNRKLLDAAVTDLETITGQKAVKTKARKSIANFKLREGNEIGAMVTLRGARMYEFLDRFINVALPRVKDFRGVNPNGFDGRGNYSVGITEQIIFPEIDFDKIERISGLNVNVVTSAETDQEARSLLAKFGMPFRK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.612 kDa

MTCYTPRLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVGDAARDSKIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFLDRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTTSSSDDMARALLGELGFPFKK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.612 kDa

MTCYTPRLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVGDAARDSKIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFLDRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTTSSSDDMARALLGELGFPFKK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.333 kDa

MAYVPRLRQEYNERVKSALKEEFSYSNIMEVPKLTKIVISRGVGGAVADKKLIDHAIDELSAISGQKAVSTISKKDVASFKLRKGMPIGAKVTLRGYRMYEFLDRLITSALPRVRDFNGIKSNGFDGRGNYNLGVTEQIIFPEIDIDAVNRIAGMDITFVTTADTDKEAKALLTELGLPFKKN

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.325 kDa

MAYTPRLKEEYKSRVISALKEEFGYTNVMQVPKLEKIVLSRGVGAAVSDKKLIDYAVDELTKITGQKAVSTISKKDVASFKLRKGMPIGAKVTLRGERMYEFLDRLITSALPRVRDFGGIKATGFDGRGNYNLGVLEQIIFPEIDIDKVNKISGMDITFVTTAKTDKEAKSLLAELGLPFKKN

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.328 kDa

MAYIPRLKEEYKSRVISALTEEFGYKNVMQVPKLEKIVISKGVGAAVSDKKLIDYAVEELTKITGQKAVATISKKDVASFKLRKGMPIGAKVTLRGERMYEFLDRLVTSSLPRVRDFSGIKATGFDGRGNYNLGVLEQIIFPEIDIDKVNKISGMDITFVTSATTDKEAKSLLTELGLPFKKN

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.754 kDa

MDKYTSRYHKFYDEVVVPKLMKELEIKNIMECPKLEKIIVNMGVGEATQNSKLIDAAMADLTIITGQKPLLRKAKKSEAGFKLREGMPIGAKVTLRKERMYDFLDRLVNVVLPRVRDFEGVPSNSFDGRGNYSVGLRDQLVFPEIDFDKVEKLLGMSITMVSSAKTDEEGRALLKAFGMPFKK

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.038 kDa

MPARLEVYYRETVVPKLMERFKYKSIMMVPRLEKISVNIGVGEAAQEPKLLETAMQELGQITGQKPQVRKAKKAISNFKLREGQAIGCRVTLRRKIMFEFMDRFISVAVPRIRDFRGLSDTSFDGRGNYNVGIREQIIFPEIDIDKVPRINGMDISFVTSAKTDEEAYELLSLLGMPFKKKNQ

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.92 kDa

MVTQYIPLKEKYEKEVVPKLMKEFNYRNINQVPRIEKIVINMGIGEGSRNADLLNKHLKELAAITGQKPVITKAKKSISNFKIRKGMNVGLKVTLRGLRMWNFLYKIANIVLPKVRDFRGLNPNSFDGHGNYSFGLTEQFVFPEITPDQSPKTQGMDIVIVTTAKTDAEAFKLLEFLGFPFKR

rplE

50S ribosomal protein L5

183 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.753 kDa

MTYDYVPLKEKYEKEVVPSMMKEFGYKNKLQVPRLEKIVINMGIGEGSRNADLIEIHARELMAIAGQKPVVTKAKKSIANFKIRKGMPLGLKVTLRGARMYNFLYKLINIVLPKLRDFRGVNPDSFDGKGNYALGLPEQLIFPEIAPDQVKRIQGMDVIIVTTAKTDEEARKLLALLGMPFKR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.09 kDa

MAARLKEKFIKEIRPALQKELGLENTMAVPRIEKIVLNMGLGEATQNSKLLDPLVADLAAIAGQKPVTTRAKKSIAAFKVREGMPIGAMVTLRGDTMYEFLDRLISVGLPRVRDFRGVSTKSFDGRGNYTLGVRDQLIFPEIDISKVEKLKGMNITIVTTAQDDNSARALLKQFGVPFRQTA

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.625 kDa

MAARLRTKYKKEIVPELNKKFKFESIMQVPRLEKIVLNVGMGEAHTNPKALEAAVEELALITGQRPVKTKAKKSIAGFKIREGMSLGCMVTLRGDYMYEFLDRLVNVALPRVRDFKGVNDKGFDGRGNYNMSIKEQIIFPEIKVDKINTLYGINMTFVTNSKSNEEALSLLAAFGMPYRNQK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.535 kDa

MATTRLKTLYQETIIPKLTQQFQYTNVHQVPKLVKITVNRGLGEAAQNAKSLEASLTEIATITGQKPVVTRAKKAIAGFKIRQGMPVGIMVTLRGERMYAFFDRLISLSLPRIRDFRGISPKSFDGRGNYTLGVREQLIFPEIEYDSIDQIRGLDISIITTAKNDEEGRALLKEFGMPFRDQ

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.78 kDa

MMELQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFLKRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTARTDEEGRALLKAFGFPLKDESR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.748 kDa

MVELQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFLKRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTARTDEEGRALLKAFGFPLKDESR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.748 kDa

MVELQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFLKRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTARTDEEGRALLKAFGFPLKDESR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.778 kDa

MVELQELYKKTITPTLQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFLKRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTARTDEEGRALLKAFGFPLKDESR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.748 kDa

MVELQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFLKRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTARTDEEGRALLKAFGFPLKDESR

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.62 kDa

MAARLRTKYKKEIVPELNKKFKFSSIMQVPRLEKIVLNVGMGEAHTNPKALEAAVEELALITGQRPVKTKAKKSIAGFKIREGMSLGCMVTLRGDYMYEFLDRLVNVALPRVRDFKGVSEKGFDGRGNYNMSIKEQIIFPEIKVDKINTLYGINMTFVTNSKSNEEAYSLLAAFGMPYRNQK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.62 kDa

MAARLRTKYKKEIVPELNKKFKFSSIMQVPRLEKIVLNVGMGEAHTNPKALEAAVEELALITGQRPVKTKAKKSIAGFKIREGMSLGCMVTLRGDYMYEFLDRLVNVALPRVRDFKGVSEKGFDGRGNYNMSIKEQIIFPEIKVDKINTLYGINMTFVTNSKSNEEAYSLLAAFGMPYRNQK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.296 kDa

MATPVRMKDKYNREVVPRLQEQFNYTNLMQVPKISKIVINRGLGEASQNAKALDGSIAEVARIAGQKPVVTRAKKAIAGFKLRAGVPVGVTVTLRARRMYEFLDRLVSVALPRIRDFRGVSPKAFDGRGNYTLGLREQLIFPEIEYDSVDKIRGMDITICTTAKTDEEGRALLAALGMPFRK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.404 kDa

MNYVPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVVSIGVGEAVRNKKLLDSAVLELAQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNSMYEFLYKLIHLALPRVKDFRGINGDAFDGNGNYSFGISEQIIFSEIDYDKIERISGLNVTIVTTASNDKESKALLLKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.417 kDa

MNYIPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVVSVGVGEAVRNKKLLDSAVLELSQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMYEFLYKLIHLALPRVKDFRGINGNAFDGNGNYSFGITEQIIFSEIDYDKIERISGLNVTIVTTASNDKESKALLLKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.416 kDa

MNYVPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVISVGVGEAVRNKKLLDSAVLELAQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMYEFLYKLIHLALPRVKDFRGINGDAFDGNGNYSFGITEQIIFSEIDYDKIERISGLNITIVTTASNDKESKALLLKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.416 kDa

MNYVPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVISVGVGEAVRNKKLLDSAVLELAQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMYEFLYKLIHLALPRVKDFRGINGDAFDGNGNYSFGITEQIIFSEIDYDKIERISGLNITIVTTASNDKESKALLLKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.307 kDa

MSYIPELKRRYRDNIVKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAVMELSQITGQKAVKTKAKKAISGFKIRQGQEIGAKVTLRGNMMYEFLYKLVNLALPRVKDFRGINGNAFDGNGNCSFGIAEQIIFSEIDYDKIERISGLNVTIVTTALNDKEGKALLAKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.273 kDa

MSYVPELKRHYKDNVIKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAISELSQITGQRAVKTKAKKAIAGFKIRQGQDIGAKVTLRGNIMYEFLYKLINLALPRVKDFRGVDGNAFDGNGNYSFGIAEQIIFSEIDYDKIERISGLNVTIVTTALNDKEGKALLSKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.307 kDa

MSYIPELKRRYRDNIVKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAVMELSQITGQKAVKTKAKKAISGFKIRQGQEIGAKVTLRGNMMYEFLYKLVNLALPRVKDFRGINGNAFDGNGNCSFGIAEQIIFSEIDYDKIERISGLNVTIVTTALNDKEGKALLAKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.318 kDa

MSYVPALKKHYKDNIIKELVSEFQYKSIMQAPKIEKIIVSMGVGDAVKNKKLLDSAVYELSQITGQRAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNIMYEFLYKLINLALPRVKDFRGVNGNAFDGNGNYSFGIAEQIIFSEIDYDKIERISGLNVTIVTTALNDREGKALLSKFGMPFSN

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.444 kDa

MATTRLKSLYQETIVPKLINQFQYTNVHQVPKLVKVTINRGLGEAAQNAKSLEASINEIALVTGQKPVVTRAKKAIAGFKIRQGMPVGIMVTLRAERMYAFFDRLVSLSLPRIRDFRGVSPKSFDGRGNYTLGVREQLIFPEVEYDSVDQVRGMDISIITTAKNDEEGRALLKELGMPFRDQ

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.521 kDa

MATTRLKTLYQETIVPKLTQQFQYTNVHQVPKLVKITVNRGLGEAAQNAKSLEASLTEIATITGQKPVVTRAKKAIAGFKIRQGMPVGIMVTLRGERMYAFFDRLISLSLPRIRDFRGISPKSFDGRGNYTLGVREQLIFPEIEYDSIDQIRGLDISIITTAKNDEEGRALLKEFGMPFRDQ

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.83 kDa

MPLDVALKKKYYDEVRPELIRRFGYQNIWEVPRLEKVVINQGLGEAKEDARILEKASKELALIAGQKPAITRAKKSISNFKLRKGMPIGLRVTLRGDRMWIFLEKLLSVALPRIRDFRGLNPNSFDGRGNYNLGLKEQLIFPEITYDMVDVPRGMDIAVVTTAKTDEEAKALLELLGFPFRK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.969 kDa

MQYIPLKEKYEKEIRNAMMKEFGYKNIHQVPRLEKIVINMGIGEGSRNKDVIDIHAKELALIAGQKPVVTRAKKSISNFKIRKGMPIGLKVTLRGLRMYNFLYKLINLVLPKVRDFRGLNPNGFDGRGNYSFGLTEQLVFPEISPDQVRRVQGMDIVIVTTAKTDEEARKLLELFGFPFKRQ

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.044 kDa

MPLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (forming bridge B1b) connecting the head of the 30S subunit to the top of the 50S subunit. The bridge itself contacts the P site tRNA and is implicated in movement during ribosome translocation. Also contacts the P site tRNA independently of the intersubunit bridge; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

21.03 kDa

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (forming bridge B1b) connecting the head of the 30S subunit to the top of the 50S subunit. The bridge itself contacts the P site tRNA and is implicated in movement during ribosome translocation. Also contacts the P site tRNA independently of the intersubunit bridge; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs (By similarity).

Belongs to the universal ribosomal protein uL5 family.

21.03 kDa

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK

rplE

50S ribosomal protein L5

182 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.752 kDa

MNELQVKFNEKVKQDIMKNFGYKSPMQIPRIKKIVINMTAGNEVSNTKAVEEVINELTLITGQTPYKTHAKKSLASFKIREGMPMGGKVTLRRDKMWDFLQKLIDIVIPRIRDFRGISPKSFDGRGNFALGIEEEIIFPEIDFDKIRRNKGLDVIIVTSANTDSEAKYLLEKLGMPFAKATN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.38 kDa

MTVRLKTLYLDTAVPKLQEQFKYKNAHEIPKVTKVSVNRGLGEASQNAKALERSLEELAVITGQRPVVTRAKKAIAGFKIRQGMPVGVMVTLRGERMYAFLDRLVNLALPRIRDFRGVSPKSFDGRGNYTLGLREQLIFPEVDYDSIDQIRGMDISIITTAKTDEEGRALLKVLGMPFREN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.606 kDa

MSLRLQEKYEKEVVPALMDKFGYKNIMQAPKLEKIVINMGVGEAKDNPKVLESAVNDLTIITGQKPVLTRAKKSIANFKLRENMAIGCKVTLRKQYMYEFADKLMNVALPRVRDFSGVSDKSFDGRGNYSLGIKEQLIFPEIEYDKIDKVRGMDIVFVTTANTDEEAKELLRLFGMPFAQK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.606 kDa

MSLRLQEKYEKEVVPALMDKFGYKNIMQAPKLEKIVINMGVGEAKDNPKVLESAVNDLTIITGQKPVLTRAKKSIANFKLRENMAIGCKVTLRKQYMYEFADKLMNVALPRVRDFSGVSDKSFDGRGNYSLGIKEQLIFPEIEYDKIDKVRGMDIVFVTTANTDEEAKELLRLFGMPFAQK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.496 kDa

MAKLHDLYKDTVVAELQKQFGYKSVMQVPRIEKITLNMGVGEAISDKKVLEHATNDLTAISGQKPITTVARKSVAGFKIREGYPIGTKVTLRGERMWEFLERLISISIPRIRDFRGLNPKSFDGRGNYSMGVREQIIFPEIEYDKIDKIRGLDITITTSAKDNEEGLALLSAFDFPFKKKV

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.318 kDa

MSMKKENTLDYSKITATLMETFNYKSVMQVPKVEKVVINMGVGDAIFNVKVLDDVVEELKLLSGQSPVITKAKKAISNFKLREGMPIGAKVTLRGARKEAFLCKLTRLVFPRVRDFRGISGKSFDGRGNYALGLKEQIVFPEINIDKVKKIRGMDIIIVTTAKNNTQAKKLLELYGMPFKN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.311 kDa

MSIKKENTLDYSKITATLMKTFNYKSVMQVPKVDKVVINMGVGDAIFNVKVLDDVVEELKLLSGQSPVITKAKKAISNFKLREGMPIGAKVTLRGARKEAFLYKLTRLVLPRVRDFRGISGKSFDGRGNYALGLKEQIVFPEINIDKVKKIRGMDIIIVTTAKNNTQAKKLLELYGMPFKN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.639 kDa

MSDTLKKYYYKKIVPKLIDQFKYKNIHQVPKLVKVTINRGLGEASQNAKALDSSIKEIATITGQKPVVTRAKKAIAGFKIRQGMPVGVMVTLRSQRMYEFIERLINLALPRIRDFRGINPKSFDGRGNYSLGVKEQLIFPEIEYDKIDQIRGMDISIITTAKTDEEGRALLKEMGMPFRSN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.094 kDa

MSRLKDKFNETIKPALVKEFDIKNPMLIPALEKIVISVGAGDSAKDQKVLQNMADTISLIAGQKAVITDAKKSVAGFKVREGFPVGIKVTLRKEQMYAFLDKLISVALPRVKDFRGLPKNGFDGRGNYNFGLSEQLMFPEVEYDKILRTHGMNITIATTAKNDKEAFKLLELFGVPFAKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.123 kDa

MGRLKDKFNESIKPALVKEFDIKNPMLVPALEKIVISVGAGDFAKDQKVLQNMADTISLIAGQKAVITNAKKSVAGFKVREGFPVGIKVTLRKEQMYAFLDKLISIALPRVKDFRGLPKNGFDGRGNYNFGLSEQLMFPEVEYDKILRTHGMNITIATTAKNDKEAFKLLELFGLPFAKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.061 kDa

MSRMKQKYNDIVPALREECGVQNTMQTPKLEKIVISVGAGEEGRDSKLIANMADTISLIAGQKAVIVNAKKSVAGFKAREGAPSGIRVTLRGDNMYNFFDKLVSIALPRVKDFRGTPRKGFDGRGNYNFGLQEQLMFPEVEFDNIIKTHGMNITIVTSTEDDKQAFTLLEKLGMPFAKGRN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.375 kDa

MSQRLKTLYQDSIVPKLTEQFGYSNVHEVPKLVKISVNRGLGEASSNAKAMESSIKELSTITGQRPVITRAKKAIAGFKIREGMPVGVMVTLRSEKMYSFLDRLISLALPRIRDFRGISPKSFDGRGNYSLGIREQLIFPEIDYDSIDQIRGMDISIITTARTDEEGRALLREMGMPFRES

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.425 kDa

MARLKDKYLNEVQPNLMQKFGYKNIMQVPKLEKVIINIGLGEAVQNSKAVDAAVGDLMAITGQRPITTKAKKSIAAFKLRAGMTIGTKVTLRGERMYEFVDRLFNVALPRVRDFRGISDKSFDGRGNYTMGLKEQLIFPEIEYDKIDKVRGMDITFVTTAKTDEEARELLKLMGIPFVKVS

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.791 kDa

MNLKQKYLTDVVPALMKQYGYKSIMQVPRLEKIVLNMTAGKEVTNSKAIEEVLNELTQISGQKPFQTRAKKSNASWKLREGMAMGGKVTLRRDRMWDFLEKFINVAMPRIRDFRGANPKAFDGRGNYSFGVKEEIIFPEIEFDKIRRIKGLDVQIITSVNNDKEARSLLELIGMPFSKGEK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.345 kDa

MIELEKHYYEKVFGQLKAHFNFKSPSQVPKITKVVVNMTAGNQSSNAKAIEAVLEDLAKITGQKAYKTVAKKSLATWKLRQGMPMGGKVTLRRQQMWNFLAKVLHIAIPRVRDFRGLSPKSFDGNGNFALGFKESIVFPEITFDKISKIRGLDVIIVTSAKNDQEGFKLLELLGFPFAKKV

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.373 kDa

MIELEKHYYEKVFGQLKAHFNFKSPSQVPKITKVVVNMTAGNQSSNAKAIEAVLEDLAKITGQKAYKTVAKKSLATWKLRQGMPMGGKVTLRRQQMWNFLAKVLHIAIPRVRDFRGLSPKSFDGNGNFALGFKESIVFPEITFDKISKIRGLDVIIVTSARNDQEGFKLLELLGFPFAKKV

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.797 kDa

MARLQKHYRDTVINQLRERLGCQSVMAVPRIEKITLNIGAGEAVGDKKILERVMGDMARISGQKPVLTRARKSVAGFKIREDWPIGCKVTLRRKQMYEFLDRLINIAIPRIRDFRGLSPKSFDGRGNYNMGIREQIIFPEIDYDQIDAIRGMNITITTTAKTDEEGQALLRAFNFPFRTHT

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.23 kDa

MNRLKQLYENSIKPAIVKEFDIKNSMLIPKLDKIVISVGVGESSKDEKILQNMADTISLIAGQKAVITNAKKSIAGFKVREGFPVGIKVTLRKDNMFVFLDKLVSIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILKTHGMNITIVTTANSDKEAFKLLELFGVPFAKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.214 kDa

MMRLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKENMYAFLDKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAQNDKQAQKLLELIGVPFTKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.228 kDa

MMRLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPIGVMVTLRKENMYAFLDKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAQNDKQAQKLLELIGVPFTKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.214 kDa

MMRLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKENMYAFLDKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAQNDKQAQKLLELIGVPFTKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.214 kDa

MMRLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKENMYAFLDKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAQNDKQAQKLLELIGVPFTKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.214 kDa

MMRLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKENMYAFLDKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAQNDKQAQKLLELIGVPFTKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.264 kDa

MMRLKEKYTQNIKPALVKEFDIKNPMLIPFIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKDNMYAFLDKLITIALPRVKDFRGLPRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTAKSDKEAQKLLELFGVPFAKGK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.278 kDa

MFGLKQFYQNEVKVKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.297 kDa

MFALREKYKNEIISQLKSELNMSNPMLLPKLEKIVISVGAGDYAKDSKIMQNIADTISLIAGQKAVITLAKKSVAGFKMREGMPMGVKVTLRGKMMYNFLEKLIVIALPRVKDFRGLKRNGFDGRGNYSFGLNEQLMFPEVVYDDIMVTHGMNITIVTSTHSDKEAFKLLELLGMPFAKGR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.315 kDa

MFGLKQFYQNEVRTKLAQELDIKNPMLLPKLEKIVISVGAGAYAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGHGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.279 kDa

MFGLKQFYQDEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.346 kDa

MFGLKQFYQNEVRIKLAQELDIKNPMLLPKLEKIVISVGAGAYAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.264 kDa

MFGLKQFYQNEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLVAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.251 kDa

MFGLKQFYQNEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDSDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.228 kDa

MFGLKQFYQSEVRTKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFLEKLIVISLPRVKDFRGISRNGFDGCGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTSTDNDKEAFKLLELLGLPFAKVR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.907 kDa

MLRFKELYQQEIIENLQKEFSYKNKHAIPQIKKVVINMGVGEAIADSKVINNAVNDLTLISGQKPVVTLARKSIATFKLRENMKIGCKVTLRKDRMYDFLERLVIVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSAKTDKESKFLLSGFNFPFYNNF

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.683 kDa

MQYIPLKEKYENEIKPAMMKEFGYKNIHQVPRLEKIVINMGIGEGSRNKDVIDIHAKELALIAGQKPVVTKAKKSISNFKIRKGMPIGLKVTLRGVNMYNFLYKLINLVLPKVRDFRGLNPNGFDGRGNYSFGLTEQLVFPEISPDQVRRVQGMDIVIVTTAKTDDEARKLLELFGFPFKR

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.359 kDa

MSQRLKDHYNKTVVPQLMQQFQYKNIHQVPKIVKVTVNRGLGEAAQNAKALEATLAEIATITGQKPVVTRAKKAIAGFKIRKGMPVGVAVTLRSERMYAFLDRLINLALPRIRDFRGVNPKSFDGRGNYTLGLREQLIFPEVNYDDIDQIRGMDVSIITTANTDEEGRALLKAMGMPFREN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.61 kDa

MAKLSDIYQEQVIDKLINQFSYKSRMQVPNIEKIILNMGVGQTVTDKKLLDNAVANLTAISGQKPIITKARKSIASFKIRHGYPIGCKVTLRGKRMWEFFDKLISIVIPRIRDFRGFSIKSFDGRGNYSIGVVEQIIFPEIDYDKIDRVRGMNITITTTANSNNEGYALLSALNFPFRKNK

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

19.899 kDa

MARMKDKYLALKAELQADLGIKNPMQTPALEKIVISVGAGFAMKDNKLIQNIEDTITTIAGQKASTVIAKKSVAGFKVREGMPVGVRVTLRGEKMYNFFDRLVSMALPRVKDFRGVPRNGFDGRGNYNFGLQEQLIFPEVSYDSVMQIHGMNITVVTSAESDKAGFALLEKMGMPFSKGSN

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.345 kDa

MIELEKHYYEKVFGQLKAHFNFKSPSQVPKITKVVVNMTAGNQSSNAKAIEAVLEDLAKITGQKAYKTVAKKSLATWKLRQGMPMGGKVTLRRQQMWNFLAKVLHIAIPRVRDFRGLSPKSFDGNGNFALGFKESIVFPEITFDKISKIRGLDVIIVTSAKNDQEGFKLLELLGFPFAKKV

rplE

50S ribosomal protein L5

181 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.529 kDa

MILKEKYLKEVKSNLQKQFNYSSSMEIPRIEKVILNMTAGKEVTNAKAIEEVINELTLISGQKPYQTVAKKSLASWKLREGMPMGGKVTLRSKNMWIFLNKLINIAMPRIRDFRGVSPKAFDGRGNYSLGIKEQIIFPEIEFDKIRKIKGLDVIIVTSAKTNKEARALLEGIGIPFAKVEK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.039 kDa

MSAAFKELYNTKIVPKLVSDFNYDSVMQVPKLEKIVVNMGVGEAVSNSKLLDQAVEELTLLTGQKPVITKAKKSISNFKLREGQSIGAKVTLRGDRMYYFLEKLVSVALPRVRDFRGVSANAFDGRGNYTLGVKEQIIFPEINIDKVNKVRGMDIIIVTTAQTDAEAKSLLTEFGFPFKK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.512 kDa

MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTKAKKSVANFKIREDMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSSKSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.512 kDa

MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTKAKKSVANFKIREDMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSSKSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.512 kDa

MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTKAKKSVANFKIREDMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSSKSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.512 kDa

MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTKAKKSVANFKIREDMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSSKSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.495 kDa

MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKALEAAVEDLAKITGQKPILTKAKKSVANFKIRENMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSSKSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.323 kDa

MTRLKDKYLNEAAPALIEKFKYSSRMQVPKLEKVVLNMGVGEVKDNPKAMDSAVNDMTLITGQKPIVTKAKKSVAAFKLRQGMNIGCKVTLRGDRMYEFVDKLFNVAIPRVRDFRGLSSNSFDGRGNYSMGIKDQLIFPEIEYDKVDKLRGMDIVFVTTAKSDEEAKELLKLLGMPFSQN

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.535 kDa

MVPRLQEKYEKEVIPALIEKFGYKNIMEVPKLEKIVINMGVGEAKENQKMLESAVSDLSIIAGQKPIVTKAKKSVANFKIRENMPIGCKVTLRKVKMYEFADKLMNVALPRVRDFRGVSSKSFDGRGNYSLGVKEQLMFPEIEYDKVDKVRGMDIIFVTTAKTDEEARELLRFLGMPFAH

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.277 kDa

MASYLAEEYKEKVAPALAEKFDYKSSMQIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFLYKLINVSLPRVRDFRGVSTRSFDGRGNYTLGVKEQLIFLEIDFDKVNRTRGLDIVIVTTANTDEEARELLTQFGMPFAR

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.258 kDa

MANSLVEKYSNEIAPAMNKKFNYDSVMEIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFLYKLINVSLPRVRDFRGISSRSFDGRGNYTLGIKEQLIFPEIDYDKVNRVRGLDVVIVTTAKTDEEARELLTEFGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.006 kDa

MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITKAKKSVAAFRLREGMPIGAKVTLRGERMFEFLDKLVTVSLPRVRDFHGVSNKAFDGRGNYTLGVKEQLIFPEINYDDVDKVRGMDIVIVTTANTDEESRELLAKLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.006 kDa

MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITKAKKSVAAFRLREGMPIGAKVTLRGERMFEFLDKLVTVSLPRVRDFHGVSNKAFDGRGNYTLGVKEQLIFPEINYDDVDKVRGMDIVIVTTANTDEESRELLAKLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.006 kDa

MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITKAKKSVAAFRLREGMPIGAKVTLRGERMFEFLDKLVTVSLPRVRDFHGVSNKAFDGRGNYTLGVKEQLIFPEINYDDVDKVRGMDIVIVTTANTDEESRELLAKLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.168 kDa

MENRLEERYSKEIAPALVSKFNYKSTMQAPKIEKIVLNMGVGDATQNAKLLDEAVDELTLISGQHPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLINVSLPRVRDFHGISPKSFDGRGNYTLGVKEQLIFPEIDYDKVNRVRGLDVVIVTTANTDEEALELLTQVGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.238 kDa

MENRLKAQYEKEIVPALVDKFNYTSVMQVPKLAKIVLNMGVGDAVTNAKNLDEAVEELTLISGQKPLVTRAKKSIAGFRLREGMAIGAKVDLRGERMYDFLDKLINVSLPRVRDFHGVSTRSFDGRGNYTLGVREQLIFPEINYDNVNRVRGLDIVIVTTADSDEESRELLTQFGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.171 kDa

MENRLKAKYENEIRPALIEKFNYSSVMQAPKIDKIVLNMGVGDATTNSKNLDEAVEELGLISGQKPLITKAKKSIAGFRLREGMSIGAKVTLRGERMYDFLDKLVNVALPRVRDFHGVSNKAFDGRGNYTLGIHEQLIFPEIDYDKVNRVRGLDVVIVTTAQTDEESRELLAQLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.171 kDa

MENRLKAKYENEIRPALIEKFNYSSVMQAPKIDKIVLNMGVGDATTNSKNLDEAVEELGLISGQKPLITKAKKSIAGFRLREGMSIGAKVTLRGERMYDFLDKLVNVALPRVRDFHGVSNKAFDGRGNYTLGIHEQLIFPEIDYDKVNRVRGLDVVIVTTAQTDEESRELLAQLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.224 kDa

MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITKAKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFPEIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.198 kDa

MTNRLKEKYVKEMTPALIEKFNYTSSMQVPKIEKIVLNMGVGDAVSNAKNLDKAVEELGLIAGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLVNVSLPRVRDFHGVSAKSFDGRGNYTLGVREQLIFPEIDYDKVDRVRGLDVVIVTTSNTDEEARELLTQFGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.

20.009 kDa

MVNALKEKYVNEVRPALISKFDYTSLMQAPKLEKIVLNMGVGDAVTNSNNLDEAVSELRLIAGQQPVVTKAKKSIAGFRLREGMSIGSKVTLRGTRMYDFLDKLINVALPRVRDFHGTSTKSFDGRGNYTLGIKEQLIFPEINYDDVNRVRGLDIVIVTTAKTDEEGLELLSQLGMPFAK

rplE

50S ribosomal protein L5

180 amino acids

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Belongs to the universal ribosomal protein uL5 family.