rpl20

50S ribosomal protein L20, chloroplastic

136 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.73 kDa

MTRVKRGSVARKRRKNILKLASGFQGAHSTIFRTGNQQIIKALASSYRDRGKRKRDFRRLWITRINAAARNNGVSYTKFIRHLYKNQVSSNRKVLAQIAIFDTNSFSTILKKLSSGESIRYRNFSPEFYSGEVRTP

rpl20

50S ribosomal protein L20, chloroplastic

132 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.967 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIKALVSAHRDRDSKKRNFRRLWIIRINAIIRERVVEWALSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNELYKYKEVEESSGII

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.853 kDa

MTRIRRGYIARRRRTKTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFRRLWITRINAAIRENGRSSIYSKLIHNLYKRQLFLNRKMLAQLAILNRNCLYMISNQILKEVDWQESATILEI

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.853 kDa

MTRIRRGYIARRRRTKTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFRRLWITRINAAIRENGRSSIYSKLIHNLYKRQLFLNRKMLAQLAILNRNCLYMISNQILKEVDWQESATILEI

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.853 kDa

MTRIRRGYIARRRRTKTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFRRLWITRINAAIRENGRSSIYSKLIHNLYKRQLFLNRKMLAQLAILNRNCLYMISNQILKEVDWQESATILEI

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.853 kDa

MTRIRRGYIARRRRTKTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFRRLWITRINAAIRENGRSSIYSKLIHNLYKRQLFLNRKMLAQLAILNRNCLYMISNQILKEVDWQESATILEI

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.853 kDa

MTRIRRGYIARRRRTKTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFRRLWITRINAAIRENGRSSIYSKLIHNLYKRQLFLNRKMLAQLAILNRNCLYMISNQILKEVDWQESATILEI

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.883 kDa

MTRVRRGYIARRRRKKMRLFVSSFRGAHSKPIRIVAQQKIRALFSAHRDRDKKKRDFRRLWITRINAAIRETEKGIYYSYSKFIHDLYKRQLILNRKILAQIAILNRNSIYSIYNEILKKEDWKDAPEML

rpl20

50S ribosomal protein L20, chloroplastic

130 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

15.342 kDa

MTRIKRGYIARKRRTKIRLFTSSFRGAHSRLTRTITQQKIKALVSAHRDRDRKKRDFRGLWISRINAVIRGNIKVYYIYSNLVYSLYTGQLLLNRKIVAQIAILKQNCLFMIANDIIKTKNPLRLYSGKV

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.33 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSSHRDRDRQKRNFRRLWITRINAVIREGGVSYSYSRLIHDLYKKQLLLNRKILAQIAISNKNCLYMISNEIIKEVDWKESTGII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.251 kDa

MTRIRRGNIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSSHRDRDKQKRNFRRLWITRINAVIREIGVSYSYSRLIHALYKKQVLLNRKILAQIAISNKNCLYMISNEIIKEVDWKESTGII

rpl20

50S ribosomal protein L20, plastid

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

15.623 kDa

MTRIKRGYIARRRIKKFRLFASSFLNAHSRLTRTITQQKIRALVSSDRDRNNKKRKFRSLWITRINAVIREEGVSYSYKNFIYAQYKIQLLINRKILAQIAILNRNFFYMIFNEIRKEADLKEYIRIN

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.344 kDa

MTRIKRGYIARRRRKKISLFASSFRGAHSRLTRTITQQRIRALVSAHRDRDRKKRDFRRLWITRINAVIRGVGVSYSYSRLIHNLYKKQLLLNRKILAQIAISNRNCLYMISNEIRKEGDRKESNEML

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Component of the chloroplast ribosome (chloro-ribosome), a dedicated translation machinery responsible for the synthesis of chloroplast genome-encoded proteins, including proteins of the transcription and translation machinery and components of the photosynthetic apparatus.

Belongs to the bacterial ribosomal protein bL20 family.

15.689 kDa

MTRVKRGYIARRRRKKIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFRRLWITRINAAIRERGVYYNYSKFIHDLYKRQLLLNRKILAQIAILNPNCIYMIYNEIIKKEDCKKYLEII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.026 kDa

MTRISRGYIARRRRRKTSLVVSSSGASLSKLITQQEIKALASSDRDRDRQKRDFRCLWITRINSVIREGWVSYSYSYSKFIHDLYKRQLLLNRKILAQIAIANKNFLYLISNQILKSEVNWKESAGVI

rpl20

50S ribosomal protein L20, plastid

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

15.439 kDa

MTRIKRGYIARRRRTKMRLFASSFRGAHSRLTRTITQQKIRALFSAHRDRDKQKINFRRLWIARINAVIRKRGVSYSYSKLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKETERKEYTGII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.243 kDa

MTRVRRGYIARRRRTKIRLFASTFRGAHSRLTRTITQQKMRALVSAHRDRGRKKRDFRRLWITRINAVIRGSGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCFYMISNQIIKSGECEEFNGII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

128 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.541 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRERGVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVDWKESTRII

rpl20

50S ribosomal protein L20, chloroplastic

127 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.032 kDa

MTRIKRGSIARRRRTKAHSFASKFREAHARLTRAITQQQIRALFSADRDRDKQKIDFRRLWITRINALIREKGVFHNYSKFINDLYKSQLLLNRKILAQIAISNRNCLYMIANEIIKKVGFESAVII

rpl20

50S ribosomal protein L20, chloroplastic

126 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.673 kDa

MTRIKRGSIARRRRAKTRLFASGARGAHSRLTRLIAQQTIRALASAHRDRDKKKRDFRRLWITRINGVIRQNVLSYSYSQLITNLKKEQLLLNRKMLAQIAISNRNCLSIIYSAIIILETKEEGQK

rpl20

50S ribosomal protein L20, chloroplastic

126 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.137 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSYSRLINDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVSWKESTG

rpl20

50S ribosomal protein L20, chloroplastic

126 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.171 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSYSRFINDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVSWKESTG

rpl20

50S ribosomal protein L20, chloroplastic

126 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.698 kDa

MIRVRRGYIARRRRTKFFLFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQKRDFRRLWITRINAVTRENGGSYSRLIHDLYKGQLLLNRKIPAQLAISNGNCLYMISNEIGSANKEIGRSSSE

rpl20

50S ribosomal protein L20, chloroplastic

126 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

15.021 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSYSRLINGLYKRQLLLNRKILAQIAISNRNCLYMISNEIIKEVGWKESTG

rpl20

50S ribosomal protein L20, chloroplastic

124 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.671 kDa

MTRIKNNGISKKKRKRKISKMKGWVGGHSKLFRTGNQQLMKARHYAFYDRKKKKNLNKTLWITRINGGLKYYLTINEKYNIFVSFLRKTKTYVNKKLLSEINVRDSKSFSHLSKPIMKSTGINL

rpl20

50S ribosomal protein L20, chloroplastic

124 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.69 kDa

MTRVKRGIVARKRRKKILNYTKGFRGAASKLFRTANQRYMKALKLSFVNRRKKKRDFRSLWISRLNAAVRKNGLNYNEFIFALKICNINLNRKTLSQISICDPQTFNLLYDTLKPLLIKHLNTK

rpl20

50S ribosomal protein L20, chloroplastic

122 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.73 kDa

MTRVRRGYTARRRRIKIRLFASTFRGAHSRLTRTTTQQKMRALVSSHRDRGRQKRDFRRLWITRINAVTRDNGVFHSYSKFIHNLYKRQLLLNRKILAQIAIENKNCLYMISNKISQIKEII

rpl20

50S ribosomal protein L20, chloroplastic

121 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.402 kDa

MTRIKRGYIARKRRTKIRLFTSSFRGAHSRLTRTISQQKIKALVSAHRDRNRKKREFRGLWISRINAGIGDNDKKKNIYYSYSNFMYNLYKKQLLLNRKIVAQIAIFKGNCLFMIANEIIT

rpl20

50S ribosomal protein L20, plastid

120 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.509 kDa

MTRVKRSIQRIIKKEFILKKAKGYKGGNSSLFKATKQTLLKAEKNAYRDRRYKQRLWNKIWITRINGLLRSYNINWSVIKFFLKNNKIKLNRHILSQVSIYDPVLLQIYILFYINTLCRI

rpl20

50S ribosomal protein L20, plastid

120 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.023 kDa

MTRIKRGSIARARRTKIRFFASKFRGSHSRLTRTIIQQGLRAFVSSQRDRHKKKRDFRRLWITRLNAAIRAIGVGYSYSASIHNLYKSQLILNRKILTQIAISNRNCLYMISNEILKSGV

rpl20

50S ribosomal protein L20, plastid

120 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.013 kDa

MTRIKRGSIARARRTKIRFFASKFRGSHSRLTRSIIQQGIRAFVSSQRDRDKKKRDFRRLWITRLNAAIRAIGVGYSYSASIHNLYKSQLILNRKILTQIAILNRNCLYMISNEILKSGV

rpl20

50S ribosomal protein L20, chloroplastic

120 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.118 kDa

MTRVKRGYIARKRRKKILAFVSGSRGAHSKLFRTANQRKARALVSVHRDRGKRKRDLRRLWITRINAAARANGVSYNRFIQYLYKRQLLPNRKTLAQIAVLDSNCFSTILKNLSYDEINR

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.124 kDa

MTRVKRGIIARKRRQKILNMNKGFRGAASVLFRTANQRYMKSLRSAYENRHNKKRNFRKLWISRLNSAVRLNGLNYSQFVYMLKKSGIILNRKILSQLSICDPQIFHELYSYIASKNLI

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.356 kDa

MTRVPRGYIARRRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRLWISRINAATRIHKVFDNYSKLIHNLYKKELILNRKILAQVAVLNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.346 kDa

MTRVPRGYIARRRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRLWISRINAATRIHKVFDNYSKLIHNLYKKELILNRKILAQVAVLNSNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.356 kDa

MTRVPRGYIARRRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRLWISRINAATRIHKVFDNYSKLIHNLYKKELILNRKILAQVAVLNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.346 kDa

MTRVPRGYIARRRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRLWISRINAATRIHKVFDNYSKLIHNLYKKELILNRKILAQVAVLNSNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.306 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVKRAFVSSHRDRGRQKRDFRRLWITRINAATRVYKVFDSYSKLIHNLYKKKLILNRKMLAQVAVSNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.32 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVKRAFVSSHRDRGRQKRDFRRLWITRINAATRIYKVFDSYSKLIHNLYKKKLILNRKMLAQVAVSNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.38 kDa

MTRVRRGYIARRRRTKIRLFASTFRGAHSRLTRTATQQKMRALVSIYRDRGRQKREFRRLWIARINAATHENGVSYSRLINDLYKRQLLLNRKIPAQIARYNLNSLYMISNEIIKEKRD

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.318 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVKRAFVSSHRDRGRQKRDFRRLWITRINAATRIFKVFDSYSKLIHNLYKKKLILNRKMLAQVAVSNPNNLYTISKKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.26 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRGRQKRDFRRLWITRINAATRVYNVFNSYSKLIHNLSKKELILNRKMLAQVAVSNPNNLYTISNKIRTIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.306 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVKRAFVSSHRDRGRQKRDFRRLWITRINAATRVYKVFDSYSKLIHNLYKKKLILNRKMLAQVAVSNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.32 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVKRAFVSSHRDRGRQKRDFRRLWITRINAATRIYKVFDSYSKLIHNLYKKKLILNRKMLAQVAVSNPNNLYTISNKIKIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.24 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRVITQQVRRAFVSSHRDRGRQKRDFRRLWITRINAATRVYNVFNSYSKLIHNLSKKELILNRKMLAQVAVSNPNNLYTISNKIRIIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.244 kDa

MTRIRRGYIARRRRTKIRLFASTFRGAHSRLTRTIIQQKMRALASSHRDRGRQKRNFRRLWITRINAAIREIGVSYSYSRSIKDLYKSQLLLNRKILAQIAISNTNCLYMISKEIIKFK

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.097 kDa

MTRIKRGYIARKRRTKIRLFVSSFRGAHSRLTRTITQQKMKALVSAHRDRDRKKRDFRGLWISRINAVIRGNPKVSYIYSNLIHSLYTRQLLLNRKIVAQIAILKENCLFMIANNIIKT

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.896 kDa

MTRVKRGYIARKRRKKILAFVSGSRGAHSKLFRTANQRKARALVSAHRDRGKRKRDLRRLWITRINAAARANGVSYNRFIQYLYKRQLLPNRKTLAQIAVLDSNCFSTIFNNLSYDEIG

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.286 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRGRQKRDFRRLWITRINAATRVYNVFNSYSKLIHNLSKKELILNRKMLAQVAVLNPNNLYTISNKIRTIN

rpl20

50S ribosomal protein L20, chloroplastic

119 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.26 kDa

MTRVPRGYIARRRRTKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRGRQKRDFRRLWITRINAATRVYNVFNSYSKLIHNLSKKELILNRKMLAQVAVSNPNNLYTISNKIRTIN

rpl20

50S ribosomal protein L20, chloroplastic

118 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.736 kDa

MTRVKRGNVARKRRKKVLKLAKGFRGSHAILFRTAKQQVLKALKYAYIGRKNRKRNYRSLWIVRINAAVRPYGITYNEFIKQLKNSSIALNRKMLSQLAILDHSVFKTILDSCTPGFK

rpl20

50S ribosomal protein L20, plastid

118 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.967 kDa

MTRIKRGSIARRRRKKMRFFASSFRGAHSRLTRTITQQGIRALVSAHRDSDRQKREFRRLWITRLNAVIRDMGISYTYSKLIHDLYNNQLLLNRKILSQIAISNSKCLYMISNGILQI

rpl20

50S ribosomal protein L20, plastid

118 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.07 kDa

MTRIKRGSIARRRRKKMCFFASSFRGAHSRLTRTITQQGIRALVSADRDRDRQKRDFRRLWITRLNAVIREMGIYYNYSKLIRDLYNNQLLLNRKILSQIAISNSKCLYMISNGILQI

rpl20

50S ribosomal protein L20, chloroplastic

118 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.67 kDa

MTRVKRGSVARKYRKNILDFVSGFRGAHSKLFRTANQRRGRSLAYAYVDKNNSKRAFRRLWIARINAAARRDGITYSSVIHSLYKNRIALNRKTLAQIATLDAYCFSMIIEKVSKIKI

rpl20

50S ribosomal protein L20, plastid

118 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.929 kDa

MTRVKRGYVARRRRKNLFTLTSGFRGTHSKLFRTANQQGMRALVASYRGRVGRKKTLRRLWIVRINAAVRSDGISYNKLIQYLYKNQILLNRKILAQIAILDRFAFFLIIRSIQREEG

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.162 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNQFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNDIKK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.227 kDa

MTRVKRGYTARRRRKKIRLFASTFIGAHSRLTRTTTQQRMRALISSHRDRSRKKRDFRRLWITRINAVTREDRLFYSYSLFIHNLYKRQLLLNRKILAQIALSNKNCFDIISNKIIN

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.175 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHETGVFYSYNRFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIKE

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.315 kDa

MTRVRRGYIARRRRTKIRLFTSTFRGAHSRLTRTTTQQKMRALVSSHRDRCRQKRDFRRLWITRINAVTRENRVSYSYSRLMHDLYKRQLLLNRKILAQIAISNRNCIYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.244 kDa

MTRIRRGYIARRRRTKIRLFASSFRGARSRLTRTIIQQKIRSLVSSHRDRDRKKIDFRRLWITRINAVIRGNRVSYSYSRLIHNLYKRQLLLNRKILAQIAILNRNCLYMISNEIRS

rpl20

50S ribosomal protein L20, plastid

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.313 kDa

MIRIKDNFKNYKKHKKILKLSKGFIGSNSKIFKISNQKIMKALYFSFSDRKKKKRSNKKIWINRINYFLKNYFFNNFNYNKIINKIKLNKICINKKILSEIIINDYKTIYKLKNMLT

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.055 kDa

MTRIKRGYIARRRRKKISLFASSFRGAHSRLTRTITQQRIRALVSAHRDRDRKKRDFRRLWITRINAVIRGVGVSYSYSRLIHNLYKKQLLLNRKILAQIAISNRNCLYMISNEIRK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.059 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQRIRALVSAHRDRGRKKRDFRRLWITRINAVIRGDGVSYSYNRFIHNLYKKQLLLNRKILAQIAISNRSCLYTISNEIRK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.105 kDa

MTRVKRGYIARRRRTKIRLFASTFRGAHSRLTRTSTQQKMRALVSTHRDRGRQKRDFRRLWITRINAVTHENRVSYSYSRLIHDLYKKQLLLNRKILAQIAISNRNCLYTICNESIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.13 kDa

MTRVRRGYIARRRRTKIRLFASTFRGAHSRLTRTITQQKMRALVSTHRDRGRQKINFRRLWITRINAVTRENRVSYSYSRLIHDLYKRQLLLNRKIPAQIAISNRNCLYTISSEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.112 kDa

MTRIRRGYIARRRRTKMRLFVSSFRGAHSRLSRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIRGNLVSYSYSRLIYNLYKAQLVLNRKILAQIAISNRNCLYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.162 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNQFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNDIKK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.125 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALASAYRDRGRQKRNFRQLWIARINAVIRSNNVDYSYSRFIHNLYKRQLLLNRKILAQIAILNRNCLYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.989 kDa

MTRVRRGYIARRRRTKIRLFAATFRGAHSRLTRAATQQKMRALVSAHRDRGKQKRDFRRLWITRINAVTRENGVCYSYSRLMHNLYKRQLLLNRKILAQIAILNKNCLHIISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.972 kDa

MTRVRRGYIARRRRTKIRLFAATFRGAHSRLTRAATQQKMRALVSAHRDRGKQKRDFRRLWITRINAVTRENGVCYSYSRLMHNLYKRQLLLNRXILAQLAILNKNCLHIISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.231 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGRRKRDFRRLWITRINAVIQEMEVFNSYNRFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.217 kDa

MTRIKRGYIARRRRTKIRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGRRKRDFRRLWITRINAVIQEMEVFNSYNRFIHNLYKKQVLLNRKILAQIALLNRSCLYTISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.149 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRLNAVIHETGVFHSYNRFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIKE

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

14.163 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNEFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNDIKK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.177 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNQFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIKE

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.935 kDa

MTRVKRGKITCRTRKKRMQSVKGFRGAWSTLSRPAMQGSLRALNYSYKHRRKNVKTFRRLSIVRFNALIRNSGLPFTYNRLIALINLYNCRLNRNVLSQLGIRDSNTFTKLMKFYYH

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.267 kDa

MTRIRRGYIARRRRTKIRLFASTFRGSHSRLTRTTTQQKIRALVSAHRDRGKQKRYFRRLWITRINAVIRDNRVFYSYSRLIHDLYKKQLLLNRKILAQIAISNRNCLYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.202 kDa

MTRIRRGYIARRRRTKIRLFASTFRGAHSRLTRTITQQKMRALVSTQRDRGRRKRDFRRLWITRINAVTRENRVSYSYSRLIHDLYKKRLLLNRKILAQIAISNRNCLDTISNEILK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.162 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNQFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNDIKK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.69 kDa

MVRVKRGNVARKRRKKILQLAKGYRGAHSRLFRVANQQVMKALRYSYVGRKQKKRVFRKLWISRINASSREKGVTYSTLINSFKKSKINLNRKMLAQIAVLDCSTFYKLIDDAKSPN

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.205 kDa

MTRTRRGYIARRRRTKIRLFTSSFRGAHSRLTRTITQQKIRALVSTHRDRDRQKRDFRRLWITRINAVIHENGASYSYSRFIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.683 kDa

MTRVKRGYVARKRHNRILKLTAGSKRAHSRLVRPAQQQAMKTLAYSHRDRNRRKRDFRHLWIARINATVRQYDVSYSQAISLIQKSKMLLNRKMLAQIAVLDNSSFNSILTAAIYST

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.166 kDa

MTRVKRGYIARRRRTKIRLFASSFRGAHSRLTRTITQQKMRALVSAYRDRGRQKRDFRRLWITRINAVTRENEVSYSYIRLIHNLYKRQLLLNRKILAQIAILNKNCLHIISKKIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.16 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHETGVFYSYNRFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIKN

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.198 kDa

MTRVRRGYIARRRRTKIRLFASTFRGAHSRLTRTTTQQKMRALVSTHRDRGRRKRDFRHLWITRINAVTRENRVSYSYSRLIHDLYKRQLLLNRKIPAQIAISNRNCLYTISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.123 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNEFIHNLYTKQLLLNRKILAQIALLNRSCLYTISTEIKN

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.172 kDa

MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTIIQQKIRALVSAHRDRDRQKRNFRRLWVTRINAVIRESTVSYSYSRLINNLYKRQLLLNRKILAQIAILNRNCLYMISNDILK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.129 kDa

MTRIKRGYIARRRRTKIRLFASSFQGARSRLTRTITQQKIRALVSAHQDRGRQKRDFRRLWITRINAVIRANKVYYSYSTLIHHLYKRQLLLNRKILAQIAILNRNCLYMISNEILK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.205 kDa

MTRIKRGYIARRRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFYSYNRFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNEIKE

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.202 kDa

MTRIRRGYIARRRRTKIRLFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQKRNFRRLWITRINAVIRENKVSYSYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEIIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.146 kDa

MTRIRRGYIARRRRTKIRLFTSSFRGAHSRLTRTIIQQRIKALFSAYRDRDRHKRNFRCLWVTRINAAIRENAVSYSYSTLINNLYKRQLLLNRKILAQLAILNRNCLYLISNDMIK

rpl20

50S ribosomal protein L20, chloroplastic

117 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.122 kDa

MTRIRRGYIARRRRTKIRLFTSSFRGAHSRLTRTMIQQKIKALFSAYRDRDRHKRNFRCLWVTRINAAIRENGVSYSYSTLINNLYKRQLLLNRKILAQLAILNRNCLYLISNDMIK

rpl20

50S ribosomal protein L20, chloroplastic

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.862 kDa

MTRVKRGYVARKRRKKVLSLTKGFRGSSSVLFRSANQRNMKALKYAYRDRRKMKREFRKLWITRINAATRMSNMTYSTFIHKLKKANIVLNRKLLAQLAVRDQQVFQQLFSYIEGV

rpl20

50S ribosomal protein L20, chloroplastic

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.638 kDa

MTRVKRGYIAKKRRKKILAFVSGSRGAHSKLFRVANQQKSRALVSAHRDRLKRKRDFRRLWITRINAASRANGVSYNKFIQFLYKRQLLTNRRTLAQIAVLNNNCFSMMLENILVS

rpl20

50S ribosomal protein L20

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.968 kDa

MVRIKRGNVARKRRQKILKAAKGFYACTTFRAANERVMKSWKASYRGRKLRKRDFRRLWITRLNAILPYKYSKFVHQLKQNQIALNRKMLYQLSCLDQKGFEQLYGLSLTRNHLIC

rpl20

50S ribosomal protein L20, chloroplastic

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

14.038 kDa

MTRIKRGYIARRRRTKMHFFASSFRGAHSRLTRTMTQQEKRALVSAHRDRDRQKRDFRRLWITRINAVIRERGVSYSYSKFIHDLYKNQLLLNRKILAQIAISNRKCLDMISNEIV

rpl20

50S ribosomal protein L20, chloroplastic

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.606 kDa

MTRVKRGYVARKRRKNILTLTSGFQGTHSKLFRTANQQGMRALASSHRDRGKRKRNLRRLWITRVNAAARDNGISYNKLIEYLYKKKILLNRKILAQIAILDKFCFSTIIKNIITE

rpl20

50S ribosomal protein L20, chloroplastic

116 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.285 kDa

MPRIKRGNVAVKRRKKILKRAKGFRGTHSKLFRVANQQVMKALRYAYVGRKRKKREFRSLWITRINAAARLNGTKYSSVIHSLKESKIAINRKMLAQMAVADPDSFVKVLSSAKAS

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.767 kDa

MTRVRRGYIARRRRRKIRLFASSFRGAHSRLTRTATQQKIRALVSSHRGRGRQKRDFRRLWITRINAVTRENGVPYSRLIHDLRKKQLLLNRKILAQIAISNRNCLYMISNDIIK

rpl20

50S ribosomal protein L20, organellar chromatophore

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.197 kDa

MARVKRGNIARKRRNKILRLARGFRGSNGSLFRTANQRVMKALCNAYRDRRRRKRDFRRLWIARINAASRLNGLSYSRLVGSLKKANIKLNRKMLALLALADPTSFANVVVVAKS

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.645 kDa

MTRIKRGYIARKRRKKILAFASGFRGAHSKLFRTADQQKIRALVSAHRDRSKRKRDLRRLWITRINAAARNNGVSYNKFIRYLYKRQLLSNRRILAQIAVLDKNCFSTIINNIIE

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.345 kDa

MVRVKRGNVAAKRRKKILKLAKGFKGAHSRLFRTANGQVMKALVYSYVGRKRRKRDFKRLWICRVNAASRSHGLNYSKLRNLMKQASLNINLKMLAQLVLFDKKAFSQIIDLVNK

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.704 kDa

MTRVKRGFIARRRRNKILTFASGFQGSHSKQFRVAKQQKKRALISAERDRMKRKRDFRRLWIARINAAVRFSGLSYSQFVYCMYKNRLSQNRKNLAQIATLCTPFFSTFSQKIMT

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.605 kDa

MTRVKRGYVARRRRKKILHLTSGFYGAHSRLFRVANQKAIRALAYSHIDRAKRKRNMRSLWICRINAVAREQNISYSYLIKSLKEKKILLNRKMLAQLAVLDKPSFIKLINTHLN

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.695 kDa

MTRVKRGYVARKRRKRVLQLTQGFRGAHSVLFRTANQQNIKALRYASRDRARRKRDFRRLWITRINAGARKQGLSYSQLMHRFKKCGILINRKVLAQLALLDTKTFNQLVFYTDL

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.474 kDa

MTRVKRGNVARKRRKQVLNLASGFRGSSSRLFRTAQQQTMKALSYSYRDRQQKKREFCGLWVTRLNAAARLYGLNYTNFRHNLKKAGIQLNRKVLSQVALRDKQAFEQLILLVKD

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.481 kDa

MVRVKRGNVARKRRKKILKLASGFKGAHSKLFRVANQQVNKSLRYSYVGRKLKKRRFRRLWILRLNAASREEGLNYSKLVNSLKLLRIQLNRKSLSQLAMIDNDAFKRLVASSRV

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.399 kDa

MTRVKRGYVARKHRKNILKFTSGFQGAHSKLFRTANQQKMKALAYAQRDRNNRKRDIRRLWITRINAACRNNGIVYNGIIHSMSEKKVHLNRKILAQIAILDSNSFFGIVKEIGM

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.528 kDa

MTRVKRGYIARRRRNRIRLFASGFKGSHSKQFRAAKQQKQRALISAKGDRIKRKRAFRRLWIARINAAVRFYGVSYSKFVHCMYKNQLPLNRKTLAQMATLHNPCFSTISQKIVA

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.363 kDa

MTRVKRGNVARKHRNKILNLAKGFRGAHSVLFRTANQQIIKSLRYAYRDRARKKRDFRKLWIARINAASRQNNISYSQLINQLKTSNILLNRKILAQIALLDGPVFSQIVMESNS

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.561 kDa

MTRVKRGYVARKRRKNIFTLTSGFQGAHSKLFRTANQQGMRALASSYRDRNRRKRDLRRLWITRINAAARNNGISYNKLIQNLYQNQILLNRKMLAQIALLDTNCFSTIMKKINE

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.576 kDa

MTRVKRGNVARKRRKKILKITKGFRGSSSTLFRTANQQQMKALRYSYRDRLTRKRNFRALWIVRINAMARHLGLNYNQFINNITKAQIIINRKTLSQLAIYDSTIFSSLISIKNN

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.267 kDa

MSRVKRGNVAKKRRAKVFKLAKGFKGAHNSLFRTAKQQVLKALRYSYVGRKRKKRDFRRLWITRINAAAHSQGMNYSTFITALKKDNIALNRKMLAQLASNDIKAFQAILETVKN

rpl20

50S ribosomal protein L20, chloroplastic

115 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.384 kDa

MSRVKRGNVAKKRRAKIFKLAKGFKGAHKCLFRTAKQQVLKALRYSYVGRKRKKRDFRRLWITRINAAAHNQGMNYSTFISALKKENIALNRKMLAQLASNDIQTFQTVLETVKN

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.486 kDa

MVRIKRGNIARKRHKKILKLAKGFRGSHSKLFRIANQQVMKALRYGYHGRKRRKREFRSLWITRINAAVRIEGTNYSCFINSLKRQHIALNRKMLAQLAVSDQNAFKQLTKITH

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.551 kDa

MTRVKRGYVARKRRRSILCQRAGSRGAHSILFRNAQQQNMKAMIYSHEHRKKRKRDFRSLWVTRINAAVREQGLSYNKFIFLLKTHKVLLNRKMLAQIAILDITSFKKLLLVIN

rpl20

50S ribosomal protein L20, cyanelle

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.355 kDa

MTRVKRGNVARKRRKKILKLASGFRGAHSRLFRVANQQVMKALRYAYNDRNKRKRDFRALWIARINASARLEGMTYSKLMGSLKKLNIILNRKSLSQLAIYDKDAFMEILKTIP

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.549 kDa

MTRVKRGNVSRKRHKKVLNLTKGFRGAASLLFRTANQQNMKALRYSYANRRKKKRNFRRLWITRVNAAIRAYGFNYSEFLYVLKNSNILLNRKILAQLAICDPDTFFKFIMSIQ

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.338 kDa

MARVKRGNIARKRAKKILQLAKGYRGAHSRLFRIANQQVMKALRYSYVGRKQKKRVFRKLWITRINAASRLNGLSYSRLIHNFKKSNIELNRKMLSQIAVLDIPTFNQLIAISK

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.953 kDa

MTRIKRGFVARKRRKKVLNLTKGFRGSSSVLFRPANQRKMKALRFSYRDRRQRKRDLRSLWITRINSASRLYNLNYSQFVYKLKQLNIHINRKWLAQLAIRDYKVFDELIKTVF

rpl20

50S ribosomal protein L20, plastid

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.414 kDa

MTRVKRGNIARNRRNEILDLAKGFRGSSSKLYRTAQQRTIKALTNSYKDRKNKKREFVKIWVSRINAAVRLSGLNYSSFQNQLKFHKIRLNRKICSQIALQDQESFTKLLDLII

rpl20

50S ribosomal protein L20, chloroplastic

114 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.493 kDa

MTRVKRGYVARRHRNRILALTSGFQGAHSKLFRTANQQGMKALTYAYRDRANCKRDFRRLWITRINAAARENQITYNNMIHSLYMNQIHLNRKILAQIAALDKDCFVEILRIIK

rpl20

50S ribosomal protein L20, chloroplastic

113 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.343 kDa

MTRVKRGYVAVRRRNRVLERAAGFRGAHSRLFRPAKQQVMKALVASKRDRDKRKRDFRKLWITRINAAVRKQGMSYSRFIHQLYQSKILINRKMIAQIAVLDENGFTSIVNNI

rpl20

50S ribosomal protein L20, chloroplastic

113 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.593 kDa

MTRVKRGYVARKRRNKILRANRSFRGTHSKLFRIANQQHMKALRYSYRDRACKKRDFRHLWITRINAVVRSYGLNYSRFMHQLRLGNMVLNRKVLSQLASLDPASFNRLIRAT

rpl20

50S ribosomal protein L20, chloroplastic

112 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.548 kDa

MTRVKRGNVSRKRHKKILNMSKGFRGAASTLFRTANQQNMKALRYSYRNRRQKKRDFRRMWITRVNSAVRRYGLNYSEFMNYLKTHKIQLNRKVIAQLSICDPEAFMQLLLF

rpl20

50S ribosomal protein L20, chloroplastic

112 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity).

Belongs to the bacterial ribosomal protein bL20 family.

13.241 kDa

MTRVKRGYVARRRRKNILKLTSGFQGAHSTLFRTANQQGMKSLTSSHRDRGKRKRDFRRLWITRINAAARRSKKSYHTLIQELYKRKILLNRKMLAQIAILDTYCFSTLLGD

rpl20

50S ribosomal protein L20, chloroplastic

112 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.029 kDa

MVRVKRGNVARKRRKKILALASGYRGAHSVLFRVANQQVMKALRYSYVGRKQKKRIFRRIWISRINAASRLNGISYSQLIHRFKKSNIDLNRKMLSQIAVLDTVAFKTLLNA

rpl20

50S ribosomal protein L20, chloroplastic

111 amino acids

Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Belongs to the bacterial ribosomal protein bL20 family.

13.208 kDa

MTRVKRGNVARKRRNKILELNRGYRGSHSTLFRTAQQRTLKALTTAYTDRRKKKRTYRRLWIRRINAAVRTKGTTYSKFIHTMKKDQIMLNRKVLSQLVILDPPSFSTLTK