RPC19

DNA-directed RNA polymerases I and III subunit RPAC2

142 amino acids

DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

16.151 kDa

MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM

rpc19

DNA-directed RNA polymerases I and III subunit RPAC2

125 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

13.722 kDa

MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDLIDLCDAVTEKFTEQLPRDTSTTMEVDG

rpc19

DNA-directed RNA polymerases I and III subunit rpc19

116 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity).

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

12.959 kDa

MTLASAPAATESCNSFIPPSFDVNKVEIISDRPDCATFIFTDEDHTLGNALHYVLMKNPKVDFSGYSIPHPSDNRMNLRIQTKSNITAQESLLQGLTDIKDISRHIFETFNNALDQ