RPC11

DNA-directed RNA polymerase III subunit RPC10

110 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Involved in Pol III transcription reinitiation and RNA cleavage during transcription termination.

Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

12.513 kDa

MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN

rpc11

DNA-directed RNA polymerase III subunit RPC10

109 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

12.815 kDa

MQFCPTCGNHLIVAVDEEGRNAFDCRTCPYHFPISTFLYSRHEFAQKEVDDVLGGEEAFESNQQTEVTCENTKCDNNRAYFFQLQIRSADEPMSTFYRCTKCKFQWREN